KEGG   Trichomonas vaginalis: TVAG_039070
Entry
TVAG_039070       CDS       T01022                                 

Definition
(RefSeq) Vesicle transport v-SNARE protein
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_039070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_039070
Membrane trafficking [BR:tva04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    TVAG_039070
SSDB
Motif
Pfam: V-SNARE V-SNARE_C DUF724 SNARE HEPN_RiboL-PSP Sec20
Other DBs
NCBI-GeneID: 4770020
NCBI-ProteinID: XP_001324282
UniProt: A2E5L8
LinkDB
AA seq 218 aa
MSDFHSMKEEIDRIKKDISNAVSNLPQYSAQERPSKMQKIEARFGEFDAAINELDLQALM
FDVNDKNAAKKYLVEVRNEYKKLQNEYTDAKRKGSERDALFGGAVRSDGSSTGQMQSLYD
QQNIINEGDNLTTELGRSVAQGHDAGVNILGELANQRNKITHIDDELNSLDTDVDTGNSI
IDRMICRNTRRTIFMIILIIILLIASGVFLYFIFKPAK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagtgattttcattctatgaaggaggagattgacagaatcaaaaaagatatctccaat
gctgtttctaatctcccacaatactctgcacaagaacgcccaagcaaaatgcaaaagatt
gaagcaagattcggtgaattcgatgctgcaatcaacgaactcgatttacaagcacttatg
tttgatgtaaacgataaaaatgctgcgaaaaagtatttagttgaagttagaaacgaatat
aagaaattacaaaatgaatatacagatgcaaaaaggaaaggaagtgagcgtgatgcctta
tttggtggtgctgttcgctctgatggctcttctacaggtcaaatgcaatcattatacgat
cagcaaaatattatcaacgaaggcgataatttaacaaccgaacttggcagatctgtcgca
caaggtcatgatgctggtgtcaatatcctcggtgaactcgcaaatcaaagaaataagatt
actcatatcgatgatgaacttaattctcttgatacagacgtcgatacaggcaatagcatc
atcgatagaatgatttgcagaaatactcgccgtacaattttcatgattattttgattatt
attcttcttattgcttccggtgttttcctctatttcatcttcaagccagctaagtaa

KEGG   Trichomonas vaginalis: TVAG_065690
Entry
TVAG_065690       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_065690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_065690
Membrane trafficking [BR:tva04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    TVAG_065690
SSDB
Motif
Pfam: Sec20 DUF2207 DUF5344 Cauli_AT Elf4 Alpha-2-MRAP_C DUF4482 V-SNARE_C YlqD DUF2884
Other DBs
NCBI-GeneID: 4764186
NCBI-ProteinID: XP_001318535
UniProt: A2ELX3
LinkDB
AA seq 213 aa
MSDLSLLRDDVSQIKTKIQEKMIGYSDLNPFQREERAKFIENLLEEYHTLITEANGQVLM
WDKAQMIAGRKFIDQTDAEMKKLEYQFREMQKRIEQREALMAGAYPPDGDSQELLSRNSD
ELNRGDRLISELSQNVSQAKDSGLNIMDALNTQRRKIQDIDEHLTRLDTNVETGELIITE
MLCRNERRKYFLWGMIALLVIAIGIFLYFLIFK
NT seq 642 nt   +upstreamnt  +downstreamnt
atgtctgacttatccctcctcagggacgatgtcagtcaaataaagacaaaaattcaagaa
aaaatgattggttattcagatttaaatccattccaaagggaagaacgagctaaatttatc
gaaaatttattagaggaataccatacacttattacagaagcaaatggacaagttttaatg
tgggacaaggcacaaatgatcgctggtagaaaatttattgatcaaacagatgctgaaatg
aaaaaattagaatatcaatttcgagaaatgcagaaaagaattgaacaacgagaagcactt
atggcaggtgcatatccaccagatggagattctcaagagttactttcaagaaactctgac
gaactaaatagaggagacagattaatatctgagcttagtcaaaatgtttcacaagcaaaa
gactccggactcaatataatggatgctttaaatactcaacgaagaaaaattcaagatatt
gacgaacatttgaccagacttgatacaaacgtcgaaactggcgaattaattattacagaa
atgctctgtaggaatgagagaagaaaatatttcctttggggtatgattgctctacttgta
attgcaatcggtatatttttatactttttgatcttcaaataa

KEGG   Trichomonas vaginalis: TVAG_068170
Entry
TVAG_068170       CDS       T01022                                 

Definition
(RefSeq) Vesicle transport v-SNARE protein
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_068170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_068170
Membrane trafficking [BR:tva04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    TVAG_068170
SSDB
Motif
Pfam: V-SNARE_C Sec20 Cas_DxTHG Laminin_II RIFIN SNARE SIR2_2 DUF745
Other DBs
NCBI-GeneID: 4764032
NCBI-ProteinID: XP_001318380
UniProt: A2EMK1
LinkDB
AA seq 192 aa
MSVDFYLEHVKGILDEVKGDMKKIESDKSEWKITIIDNMLDKIHGAKESLKEIQSEMNLV
PTTEKYNVMKSVQQYSNDIELIENSLNNNRQRSQLMAGATPQSMGVQESLIGISQTMSET
NNIGNGILTQLSNQRNKLMHAHGNVHQIDDTVSQARQVVQRMIQRANQNKLIAYGCVALL
VIGILLVLYIYF
NT seq 579 nt   +upstreamnt  +downstreamnt
atgtctgttgacttttaccttgaacatgtaaaaggtattcttgatgaagtcaaaggcgac
atgaaaaagattgaatctgataaatctgaatggaaaatcacaataattgacaacatgctc
gataaaattcatggagccaaagaatctttgaaagaaatacaaagcgaaatgaatttagta
cctactacagaaaagtataacgttatgaaatcggtccaacaatattcaaatgatatcgaa
ttaatcgaaaattcacttaacaacaacagacagcgatctcaattgatggctggtgctaca
ccacaatcaatgggtgtccaagaatcgctgattggcatctctcagacaatgagcgaaaca
aataatatcggaaatggaattttgacacagttatcgaaccaaagaaacaaacttatgcac
gcacatggaaacgttcatcaaatagatgacacagtttctcaagcaagacaagttgttcaa
agaatgatacaaagagctaatcagaacaagctaattgcatacggatgtgttgctttgtta
gttattggtatccttttagtactttatatttacttttaa

KEGG   Trichomonas vaginalis: TVAG_331320
Entry
TVAG_331320       CDS       T01022                                 

Definition
(RefSeq) Vesicle transport v-SNARE protein
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_331320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_331320
Membrane trafficking [BR:tva04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    TVAG_331320
SSDB
Motif
Pfam: V-SNARE RIFIN V-SNARE_C SNARE DUF5089 Synaptobrevin DUF3671 Laminin_II DDHD DUF1664 FadA RNase_H2-Ydr279 CDC13_N
Other DBs
NCBI-GeneID: 4750168
NCBI-ProteinID: XP_001305386
UniProt: A2FRJ4
LinkDB
AA seq 215 aa
MSAATSKLDNALSEAEGLLDQIKSDMGRLDGQPLDKRRALDAEIERKISSLENLLNKMTA
DLRSVTQQSSKSFYEGEIKNYRAEHSKVIEELRQKRRAAENDPALRQQQQLANNYEKSNQ
INDNLDEAIRTGNNTLATGNTIMATLVDDRKHLEHIDSNLDKIDQQAEQGNKTTKDMLRR
ACCNGVIAWIIVILLAIIFFASLGYKIHKNNNKSK
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagtgcagcgacatctaaactcgacaatgccctctcagaggccgagggtcttcttgat
caaatcaagagtgatatgggtcgccttgatggccagccattggataagaggagagccctt
gatgctgaaattgaaagaaagatttcttcactggagaatcttctcaacaagatgacagct
gatcttaggtcagtaacacagcagtcatcaaagagcttttatgagggagaaataaagaat
tatcgtgcagagcattccaaagtcattgaagaacttcgccaaaaacgtcgtgctgccgag
aacgatccagccttacgtcagcaacagcagcttgctaacaactatgaaaagtcaaatcaa
attaatgacaaccttgatgaagccatccgcactggtaacaacactctcgccacgggcaat
acaattatggccacacttgttgatgaccgcaagcatctcgagcatatcgactcaaatctt
gacaagatcgaccaacaggctgaacaaggcaacaagacaaccaaggacatgcttcgccgt
gcttgctgcaacggtgttattgcttggatcattgtcatccttttagctataatattcttt
gcttctcttggatataagattcataagaataataataaatcaaaataa

KEGG   Trichomonas vaginalis: TVAG_397160
Entry
TVAG_397160       CDS       T01022                                 

Definition
(RefSeq) Vesicle transport v-SNARE protein
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_397160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_397160
Membrane trafficking [BR:tva04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    TVAG_397160
SSDB
Motif
Pfam: V-SNARE_C Sec20 V-SNARE Snapin_Pallidin HMMR_N DUF2408 FadA CENP-F_leu_zip DUF2730 DUF496
Other DBs
NCBI-GeneID: 4772985
NCBI-ProteinID: XP_001327208
UniProt: A2DXA3
LinkDB
AA seq 195 aa
MSAEFYSEEIKGIIREVTNDAHKMDSGELQWTEPVIEDMLNKISGAKDALTELENEIILV
TTNEKYEYQKLVQNYKTEISNLEDKLKTTQKRVALLANAKVTDRERQAAVSLNETQAVMS
QTVDIGNGILTSLRDQRTKLLNTHQHVHEIDATVDDTGNIVSRMFKRQNKNKLITYGVVG
LLILGILLILYLKFF
NT seq 588 nt   +upstreamnt  +downstreamnt
atgtctgctgagttttattccgaagagattaaaggaatcattagagaagtcacgaatgat
gcacataaaatggatagcggtgagcttcaatggacagaaccagttatagaagacatgtta
aacaaaattagtggtgcaaaagatgcacttaccgaattagaaaacgaaatcattcttgtt
acaacaaatgaaaagtatgaatatcagaaacttgtccaaaattataaaaccgaaatttca
aatctcgaagataagttgaaaactacacaaaaaagagtcgctttactcgctaatgccaaa
gttacagacagagaacgccaagcagccgtatctctaaatgaaacacaggctgttatgtcg
caaacagttgatattggcaatggaatcctaacatcactcagagatcaacgaacaaaatta
ctcaacacacatcagcacgtccatgaaatcgatgcaacagttgatgatactggaaatata
gtttcaagaatgtttaagagacaaaataagaacaaactcataacatacggagttgttggc
cttttaatactaggaattttattaattctctatcttaagttcttctaa

DBGET integrated database retrieval system