KEGG   Trichomonas vaginalis: TVAG_064890
Entry
TVAG_064890       CDS       T01022                                 

Definition
(RefSeq) Calx-beta domain containing protein
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_064890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_064890
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     TVAG_064890
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_064890
SSDB
Motif
Pfam: Alpha_L_fucos Calx-beta F5_F8_type_C Thioredoxin_10 CE2_N FeoB_associated
Other DBs
NCBI-GeneID: 4765836
NCBI-ProteinID: XP_001320164
UniProt: A2EHG3
LinkDB
AA seq 1021 aa
MIFFSILTNSVKPPAPWGPQGTHAQIQYQREELAAFVHYGMNTYTGVEWGNGHENEDLFN
PTNLNTDQWVTSIQKAGFKRLIFVGKHHDGFCIWKTNYTVHNVNRSAKFQATSKQRGQSG
DVIEELSKSCSKYNMNMGFYLSPLDMNNSAYGNEELYNEFYMNQLREILGNKKYGNNGKF
VEVWMDGAKSEAAKDQKYWFLKWFDIIDKLQPDSVVFSPYGSTVRWIGNERGYAGNLCWS
RVNLSRMRGGNTIGLGEYEYYFHGDPDGDIWSVGECDVSITSGWFWTEGRVPKSMQELAD
IYFNSVGHGQPLLLNVPPNKEGVLPDNMVKRLEEFGETIRKTYEVNFANQPDVKVTASSF
RGNDPQFKPENAVDDNISTYWTMDDNVTKGWIEIDLGQKRTFDIVSFSEHIDLGQRVEEW
FLYYFDSSKNDWVLFENGTTINTRHLCWQHPVTSQKIKLVITKSQDVPLIERIGVYKGYG
AFSKKSLIPEGLTEVLAAKFNKTGNWNNEDEGIWTRQVGASVSYKFIGSKVYVVGIVDPG
HGKIGVYIDGNKITVINTKADERKLRQLLYTSPDLDYGDHEIKLVLESTACALHGFYYLD
NKGMGMFQIRNANYAIAKGGKVKIQVDRIGGSSGKCSVTFQTVPGTAVHGKHYINVLEKL
NFEDGEKTKLILVKTIENPEITSNLTFFAQVVDPSEGSLIGFNDISEITIYDGKPIEGLI
DIDRKDMDFDGSWEDKGDVVVSSDVGANIEAQFYGTKVFIIGNKSPNTGEILVFIDNKKV
GIIDTHSEYLQKDQLLFTSDDLELPNSLSLSSHSIVLVLISKRCEIKKFTVLENNATGMI
SLENEKLTIKGGNKIDFKILRSGGNDGECSVRLQTLPGTAVEGKDYKPIDQIVSFLTGQN
EKKVQIETMENDKDDVDFYLTISEPTNDVVVKFNSSCAIKISNTIPSPITETPVPPISYT
STPDPQPKNKKVMIIVISLSCGIIVVAILGFIIYRIVKSRENEKFPMISKELSSGSNTNY
I
NT seq 3066 nt   +upstreamnt  +downstreamnt
atgattttcttctctatactgacgaatagtgtaaaacctccagctccatggggaccacaa
ggaactcatgctcaaatacaatatcaacgtgaagagttagctgcttttgtccattacgga
atgaacacttatactggtgttgaatggggaaacggacacgaaaacgaagatttgtttaac
cctacaaatttaaatacagatcaatgggtcacatcaattcaaaaagctggatttaagaga
ttaatttttgttggaaagcatcatgatggattttgcatttggaaaaccaattacacagtt
cacaatgttaatcgtagtgctaaattccaagctacttctaaacagcgcggtcaatcaggt
gatgtcattgaagaattatctaagagctgttcaaaatacaacatgaacatgggattttat
ttatctccattggatatgaacaattctgcctatggaaatgaagaactttacaatgaattt
tacatgaatcaacttcgagagattcttggaaacaagaaatacggaaacaacggtaaattt
gttgaagtttggatggatggcgccaagagtgaagcggcaaaagatcagaagtactggttc
ttgaaatggtttgatattattgacaaattacaaccagattcagttgtattttctccatac
ggatccacagtcagatggattggtaatgagcgtggttacgcaggcaatctttgctggtca
agagtaaatttatcacgtatgagaggaggcaatacaattggtcttggcgaatatgaatac
tacttccacggtgatcccgatggcgatatctggagtgtcggcgaatgcgatgtatcaatc
acatcaggttggttctggacagaaggacgcgttccgaagtcaatgcaagaactcgctgat
atctatttcaattccgttggtcatggtcagccattgttattaaatgttcctccaaataag
gaaggtgttcttccagataacatggtcaaacgtcttgaagagttcggagaaacaattaga
aagacttacgaagttaatttcgctaatcaaccagatgtaaaagtgacagcaagtagtttc
agaggaaatgatccacaattcaagccagaaaacgctgttgatgacaatatttcgacatat
tggacaatggacgataatgttacaaaaggttggattgaaattgatctcggacaaaaacgt
acttttgacattgtttctttctcggaacacattgatttaggacaaagagttgaagagtgg
tttttgtactatttcgattcatctaaaaatgattgggttttattcgaaaatggaacaaca
ataaacactcgtcatctttgttggcaacatcctgtcacatcacaaaaaatcaaactagtt
attactaaatctcaagatgttcctttgatagaaagaatcggtgtttacaaaggatacgga
gctttctcgaagaagagtttaattcctgaaggtttgacagaagttttagccgcaaagttc
aataaaacaggaaattggaacaatgaagatgaaggtatttggacgagacaagttggagca
tcagtaagttataaattcataggatcaaaagtttatgttgtaggaattgttgatccagga
catggaaaaataggtgtttatattgatggaaacaaaattactgtaattaatacgaaagct
gatgaaagaaaacttcgtcaattactttatacaagtcctgatttagattacggtgaccat
gagattaaacttgttttagaatcaactgcttgcgcattacatggattttattacttggat
aacaaaggaatgggaatgttccagataagaaatgcaaattacgcaattgctaaaggtgga
aaagtgaagatccaagtcgatagaattggaggatcttctggaaaatgttctgtaacattc
caaacagttcctggaacagctgttcatggaaaacattatatcaatgttttagaaaaactt
aacttcgaagatggtgaaaaaaccaaattaatattagttaaaactattgagaatcctgag
ataacatcaaatcttaccttcttcgcacaagttgttgatccaagtgaaggttctttgatt
ggttttaatgatatatcggaaataacaatttatgatggaaaaccaatcgaaggattgatt
gacatcgatagaaaagatatggatttcgatggatcatgggaagataaaggagatgttgta
gtttcaagtgatgtcggtgcaaacatcgaagcacaattttatggaacaaaagtcttcatt
attggtaataaatctccaaatactggagaaattttggtttttattgataacaaaaaagtt
ggaattatagatactcattccgaatatttacaaaaagatcagttattatttacttctgat
gacttggaattgccaaattctctttctctttcatcacattctattgttttagttttgatt
tcaaagagatgtgaaatcaagaaatttactgtgttggaaaacaacgcaacaggaatgatc
tcattggaaaatgagaaactgacaatcaaaggaggaaataaaattgatttcaagatatta
agaagtggcggaaatgatggagaatgctctgttagattacaaactcttccaggaacagct
gttgaaggaaaggattacaaaccaattgatcaaatcgtcagtttcttgacaggacaaaat
gaaaagaaagtgcagatagaaacaatggaaaatgataaagatgatgttgatttctatctt
acaatttcagaacccacaaatgatgttgttgttaaattcaatagttcatgtgcaatcaag
atttcaaacacaattccttctccaattacagaaacaccagttccaccaatctcttataca
tctactccagatccacaaccaaagaataagaaagttatgatcattgttatttctctttct
tgcggaattattgtcgttgcaattttgggatttatcatttacagaattgttaagagcaga
gaaaatgaaaagttccctatgatcagcaaagagttgtcttctggatcaaacacaaattat
atttaa

KEGG   Trichomonas vaginalis: TVAG_443530
Entry
TVAG_443530       CDS       T01022                                 

Definition
(RefSeq) Calx-beta domain containing protein
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_443530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_443530
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     TVAG_443530
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_443530
SSDB
Motif
Pfam: Alpha_L_fucos Calx-beta F5_F8_type_C CE2_N Psg1
Other DBs
NCBI-GeneID: 4761714
NCBI-ProteinID: XP_001316088
UniProt: A2ETX7
LinkDB
AA seq 1032 aa
MILFNTLSLARTNAILKKSVLLQSTYSRLYAKSQKSKSSKAGSLTVDPPQPWGPIPTQGQ
INYHREELSAFIHYGMNTFTGVEWGNGHEDENLFVPDGLNTDQWVATLKKAGFKRIIMIG
RHHDGFCLWKSNYTQHQVNASKQFQETSKKLGQSGDVIEELSKSCSKYDMNMGVYLSPWD
ANSSYYGNEQLYNEYYMNQLSEVLGSADKRYGNKGKFVEVWMDGAKGTGAADQKYWFLKW
FELIERLQPGAVVFSPYGSTVRWIGNEAGHAGETCWSKLNQTRQRAWYDKTGGDEPAYLN
AGDPTGDIWSIGECDVSLTSGWFWKAGKVPKTMQELSDLYFKSVGRGQPFLLNVPPNTTG
LMDQAFLNRVAELGDTIDKTFSLNFASTPTASATASSYRGNDDKYSPKNAIDDKFETYWT
MDDDKKTGWIEIDLGQTRKFDIVSISEHIELGQRVEKFLVEYQAENSQTWNKFEEGTTIG
AKRLCRQIAVTARKVRITIVSSQAVPIIDKIGVYKAYGEFELGSGIPDGLVEVLSDKFIL
ADRWNHESEGIWTTKVAAFAQYEFTGSKFFVYGIVDPSHGHVDVFVDDQKVDTFDSHASE
RKLRQLLFSSPDFAYGKHTVRLVLVDKAMALHSLELLTNEGRGMFEIEKLDYDVPKGGKF
QLKIKRVGGVDGECKVTLQTTHGSAVHDRHYEDITLDLEYKQNENEKTVFIHTINNTETT
GNLTFFCQIVDPTNKAIIGYNQLSTVTIYNGKVPPEALIKVTADKFTTSGEWHDFDESNG
AENGIWSEVNGSYAEYTFSGTKCYVFGTTGKKDSFVEVYVDGVKARSFFVFAGEIHKNVL
IFESNDLTNHDLHTVKVLLYDGFIGVNYLQILDNDEAGIYEFNMTRRIVHNGDKTSTTVK
RLGGDKRKSYVTVKSKDGTAKSDVDYKPINTKLFFDVNENAKEVIIETIENKDHDKNITF
NLEISDATNDALIVFNNVTEIEINAKPNPTELPTPTPSPAKENTTKFVIIFVAVLVVILV
CVAVIFVAMRNH
NT seq 3099 nt   +upstreamnt  +downstreamnt
atgattctttttaatactctaagtctagcaagaacaaacgctattctgaaaaaatcggta
ctattacaatcaacatattctcgtttatatgctaaatcccaaaaatctaaatcatcaaaa
gctggatctttaactgttgatccaccacagccgtggggaccgattccaacacaaggacaa
atcaattaccatagagaagaactttccgcattcattcactatggcatgaacacatttaca
ggagttgaatggggtaatggccatgaagatgagaatttattcgttcctgatggattgaat
acagaccaatgggttgcaacacttaagaaagccggttttaagagaattattatgattgga
cgtcaccatgatggattttgcctctggaagtccaattacacccaacaccaagttaatgca
agtaagcaattccaagaaacatccaagaaattaggtcaatctggtgatgttattgaagaa
ttgtcaaagagttgctcaaagtatgacatgaacatgggagtttacttatctccatgggat
gccaactccagttattatggaaatgagcaactttacaatgaatattacatgaaccagctc
agtgaagttcttggaagtgcagacaagcgctatggtaacaaaggcaagtttgttgaagtc
tggatggatggcgctaaaggaacaggtgcggcagatcaaaagtattggttcttgaaatgg
ttcgaactgattgaaagattacaaccaggagctgttgtcttctctccatacggttcaact
gttcgttggattggaaacgaagcaggtcacgctggcgaaacttgctggtccaaattaaac
cagacaagacaaagagcatggtacgataagaccggtggtgatgagccagcatatcttaat
gcaggtgatccaacaggagatatttggtctatcggtgaatgcgatgtttcattaacttca
ggatggttctggaaagcaggcaaagttccaaagacaatgcaagaactctctgatttatac
ttcaagtccgttggccgtggtcagccattcttattaaatgttccaccaaatacaaccggt
ttaatggatcaggccttccttaacagagttgccgagcttggagacacaattgacaagaca
ttctctctcaactttgcttcaacaccaactgcatctgcaacagcatcaagctacagagga
aatgatgacaaatacagtccaaagaatgcaattgatgacaaattcgagacatactggaca
atggatgatgacaagaagacaggatggatcgaaattgatttaggacaaacaagaaaattc
gatatcgtttcaatttctgaacatatcgaacttggccagcgtgttgagaagttccttgtt
gaataccaagcagaaaattcacagacatggaacaaattcgaagaaggaacaacaattggc
gctaagagattatgtcgccaaattgcagtaacagcaagaaaagttagaattacaattgtt
tcatcacaagctgttcctatcattgataagattggtgtatacaaggcttatggtgagttc
gaattaggatcaggaattcctgatggtttagtcgaagttttgtctgataaattcattttg
gctgatagatggaaccatgaaagtgaaggaatttggacaacaaaggttgctgcttttgca
caatatgaatttactggctccaagttctttgtttatggtattgttgatccaagtcatggc
catgtcgatgtttttgttgatgatcagaaagtagatactttcgattcacatgcctctgaa
agaaaattacgtcaattactcttctcttcaccagactttgcttatggaaaacatacagta
agattagttcttgttgataaggcaatggcacttcattctcttgaattacttacaaatgaa
ggccgtggtatgtttgaaatcgaaaaattagattatgatgtaccaaaaggtggcaaattc
caactcaagattaagagagttggcggtgtagatggtgaatgtaaagttacattgcaaaca
acacatggatctgctgttcatgacagacattatgaagatataacacttgatttagaatac
aaacaaaatgagaatgaaaagactgtttttatccatacaatcaataacacagaaacaaca
ggaaatcttacattcttctgccaaattgttgatccaacaaacaaagcaattattggatat
aaccaattatcaactgttacaatatacaacggaaaggttcctccagaggcattgattaaa
gtaacagctgataaattcacaacatctggcgaatggcatgatttcgatgaatcaaatgga
gctgaaaatggaatttggtcagaagtcaatggatcgtatgctgaatacacattctcaggt
actaaatgctacgtatttggaacaacaggaaagaaagattcctttgttgaagtttatgtc
gatggtgtcaaggccagatcattctttgtctttgcaggtgaaatccataagaatgttctt
atcttcgaatcgaatgatttaactaaccatgatttacacactgttaaagttttgttatat
gatggtttcatcggtgtaaactaccttcaaattcttgataacgatgaagcaggtatttat
gaatttaacatgacaagaagaatagttcataacggagacaaaacatcaactacagtaaag
agattaggtggtgacaagcgtaaatcatatgtcacagtcaaatctaaggatggaacagcg
aaaagtgatgttgattacaaaccaatcaatactaaattattcttcgatgttaatgaaaac
gcgaaggaagtaataatagaaacaatagaaaacaaagatcatgataagaatattacattt
aatctagaaattagtgatgcaacaaatgatgctttaattgtattcaataacgtaactgaa
atcgaaatcaatgctaaaccaaatccaactgaattaccaacaccaactccaagcccagct
aaggaaaatacaactaaatttgttattatatttgttgctgttttggttgttattttggtt
tgtgttgctgttatctttgtagcaatgagaaatcattga

DBGET integrated database retrieval system