KEGG   Trichomonas vaginalis: TVAG_074640
Entry
TVAG_074640       CDS       T01022                                 

Definition
(RefSeq) O-Glycosyl hydrolase family 30 protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00600  Sphingolipid metabolism
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    TVAG_074640
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_074640
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TVAG_074640
SSDB
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C
Other DBs
NCBI-GeneID: 4770603
NCBI-ProteinID: XP_001324859
UniProt: A2E3Y1
LinkDB
AA seq 478 aa
MLTSLCMSNLGPHREGFRGLPNADDVYAYTTTGDQSKLFEPSVISFNKVSGNNPTVVINP
DSKFQTIDGFGAAITGSTAYNLNQMTQEARDKFLKDTFDPDTGMGYSFIRISIGCSDFSL
KDFTDCDKEGIDNFALDSEDTDLIIPIIQQILKINPSVKIIATPWTPPIWMKVSDLFTLR
RHNSFISGYLDPRLYQEYATYFVKYVQAMAKYNLHIYAITVQNEPLNKGNSASCFMGYKQ
QRDFIKTALGPQFAANNISTKIIIYDHNYNYDNIITQQHYPVHIYDDAEANKYIDGAAYH
AYGGSNTEMDYVTSKYPNKNLYFTEMSIGEWNYDFQGDLMWNTREIGIGTLNKGSKCAIM
WNLLLDTNHGPYRPKGCSNCYGAVDVKVPGYSELIYRSHYYDMAHLSKVIKPDSIRLGTT
VSGSSNVYATSAINTNGYIGAVLLNDQDQDVTVSVQCGSHAFDVPMPKRSVVSVIWKQ
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgcttacctccctttgtatgtcaaatctaggtcctcatagagaaggatttcgtggatta
ccaaatgcagatgatgtgtatgcatatacaacaacaggcgatcaaagcaaacttttcgaa
ccatctgtaatttcatttaataaggtttctggcaataatccaactgttgtcatcaatcca
gactcaaagttccaaacaatcgatggatttggagctgctattacaggttctacagcatat
aacttaaatcaaatgactcaagaagcaagagacaagttccttaaagatacattcgatcca
gacacaggtatgggttattctttcattcgtatttctatcggctgctcagacttttctctc
aaagatttcacagattgtgataaagaaggaattgacaatttcgcacttgattccgaagat
acagaccttatcatcccaattatacagcaaattctcaagattaacccttctgttaaaatc
attgcaactccatggactcctcctatttggatgaaggtttcagacttgtttacccttaga
agacataattccttcatttctggctaccttgatccaagactttaccaagaatatgctact
tattttgtcaaatacgtccaagcaatggccaaatacaatttacacatctacgccatcaca
gtacaaaatgagccacttaataaaggcaactccgcttcttgtttcatgggctacaagcaa
caaagagattttattaagacagctcttggtccacagttcgctgcaaacaacatttcgaca
aagattattatttacgaccacaattataactacgataacattattactcaacaacattat
ccagttcacatttacgatgacgccgaggctaataaatacattgatggtgctgcttatcat
gcttatggtggttccaacacagaaatggactatgttactagcaaatatccaaataagaat
ttatatttcacagaaatgtcaattggcgaatggaattacgatttccagggtgacttgatg
tggaatacacgtgagatcggtatcggaacccttaacaaaggcagcaaatgtgcaattatg
tggaatttgcttcttgatacaaaccatggaccatatcgtccaaagggatgctccaattgc
tatggagcagttgatgttaaagttcctggctactcagaactcatttacaggtctcattac
tatgatatggcacatctttccaaagttattaagccagactcaatcagacttggaacaact
gtctcaggaagctcaaatgtctatgcaacatcagctattaacacaaatggatacattggc
gctgttttacttaatgatcaggaccaagacgtcacagtttcagtccaatgtggctcccat
gcatttgatgtcccaatgccaaagagatctgttgtttccgtcatttggaaacaataa

KEGG   Trichomonas vaginalis: TVAG_508090
Entry
TVAG_508090       CDS       T01022                                 

Definition
(RefSeq) glucosylceramidase precursor
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00600  Sphingolipid metabolism
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    TVAG_508090
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_508090
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TVAG_508090
SSDB
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydr_30_2
Other DBs
NCBI-GeneID: 4725847
NCBI-ProteinID: XP_001281437
UniProt: A2HQ10
LinkDB
AA seq 239 aa
MSNLGPHREGFRGLPNADNVYAYTTTGDQSKLFEPSVISFNKVSGNNPTVVINPDSKFQT
IDGFGAAITGSTAYNLKQMTQEARDKFLKDTFDPDTGMGYSFIRISIGCSDFSLKDFTEC
DKEGIDNFALDSEDTDIIIPIIQQILKINPSVKIIATPWTPPIWMKVSDLSTLRRHNSFI
SGYLDPRLYQEYATYFVKYVQAMAKYNFHIYAITLQNEPLNKGNSASCFMGYEQQRDFY
NT seq 720 nt   +upstreamnt  +downstreamnt
atgtcaaatctaggtcctcatagggaaggatttcgtggattaccaaatgcagataatgtg
tatgcatatacaacaacaggcgatcaaagcaaacttttcgaaccatctgtaatttcattt
aataaagtttctggcaataatccaacagttgtcatcaatcctgattcaaagttccaaacg
atcgatggatttggagctgctattacaggttccacagcatataacttaaaacaaatgact
caagaagcaagagacaagttccttaaagatacattcgatccagacacaggtatgggctat
tctttcattcgtatttctatcggttgctcagacttttctctcaaagatttcacagaatgt
gataaagaaggaattgacaatttcgctcttgattccgaagatacagacattatcatccca
attatacagcaaattctcaagattaacccttctgttaaaattattgcaactccttggact
cctcctatttggatgaaggtttcagacctgtccacccttagaagacataattccttcatt
tctggttaccttgatccaagactttaccaagaatatgctacttattttgtcaaatacgtc
caagcaatggccaaatacaattttcacatctacgccatcacattacaaaatgagccactt
aataaaggcaactccgcttcttgtttcatgggctacgagcaacaaagagatttttattaa

KEGG   Trichomonas vaginalis: TVAG_511530
Entry
TVAG_511530       CDS       T01022                                 

Definition
(RefSeq) glucosylceramidase precursor
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00600  Sphingolipid metabolism
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    TVAG_511530
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_511530
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TVAG_511530
SSDB
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C DUF4828
Other DBs
NCBI-GeneID: 4727467
NCBI-ProteinID: XP_001283017
UniProt: A2HKI0
LinkDB
AA seq 243 aa
MGYEQQRDFIKTALGPQFAANNISTKIIIYDHNYNYDNIVTQEHYPVHIYDDAEANKYID
GAAYHAYGGSNTEMDYVTSKYPNKNLYFTEIAIGEWNYNFQGDLMWNTREIGIGTLNKGS
KCAIMWNLLLDTNHGPYRPNGCSNSYGAVDVKVPGYSELIYRSHYYDMAHLSKVIKPDSI
RLGTTVSGSSNVYATSAINTNGFIGAVLLNDQDQDVTVSVHCGSHAFDVPMSKRSVVSVI
WKQ
NT seq 732 nt   +upstreamnt  +downstreamnt
atgggctacgagcaacaaagagattttattaagacagctcttggtccacagttcgctgca
aacaacatttcgacaaagatcattatttacgaccataattataactacgataacattgtt
actcaagaacattatccagttcacatttacgatgacgccgaggctaataaatacattgat
ggtgctgcttatcatgcttatggtggttccaacacagaaatggactatgttactagcaaa
tatcctaataagaatttatatttcacagaaatagcaattggcgaatggaattacaatttc
cagggcgacttgatgtggaatacacgtgaaatcggtattggaacccttaataaaggcagc
aaatgcgcaatcatgtggaatttgcttcttgatacaaaccatggaccatatcgtccaaat
ggatgctccaattcctatggagcagttgatgttaaagttcctggttactcagagctcatt
tacaggtctcattactatgatatggcacatctttccaaagttattaagccagactccatc
agacttggaacaacagtctcaggaagctcaaatgtctatgctacatcagctattaacaca
aacggattcattggcgctgttttacttaatgatcaggaccaagacgtcactgtttcagtc
cactgtggctcccatgcatttgatgtcccgatgtcaaagagatctgttgtttccgtcatt
tggaaacaataa

KEGG   Trichomonas vaginalis: TVAG_525180
Entry
TVAG_525180       CDS       T01022                                 

Definition
(RefSeq) glucosylceramidase precursor
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00600  Sphingolipid metabolism
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    TVAG_525180
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_525180
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TVAG_525180
SSDB
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydr_30_2
Other DBs
NCBI-GeneID: 4725136
NCBI-ProteinID: XP_001280764
UniProt: A2HRY3
LinkDB
AA seq 239 aa
MSNLGPHREGFRGLPNADNVYAYTTTGDQSKLFEPSVISFNKVSGNNPTVVINPDSKFQT
IDGFGAAITGSTAYNLKQMTQEARDKFLKDTFDPDTGMGYSFIRISIGCSDFSLKDFTEC
DKEGIDNFALDSEDTDIIIPIIQQILKINPSVKIIATPWTPPIWMKVSDLSTLRRHNSFI
SGYLDPRLYQEYATYFVKYVQAMAKYNFHIYAITLQNEPLNKGNSASCFMGYEPTKRFY
NT seq 720 nt   +upstreamnt  +downstreamnt
atgtcaaatctaggtcctcatagggaaggatttcgtggattaccaaatgcagataatgtg
tatgcatatacaacaacaggcgatcaaagcaaacttttcgaaccatctgtaatttcattt
aataaagtttctggcaataatccaacagttgtcatcaatcctgattcaaagttccaaacg
atcgatggatttggagctgctattacaggttccacagcatataacttaaaacaaatgact
caagaagcaagagacaagttccttaaagatacattcgatccagacacaggtatgggctat
tctttcattcgtatttctatcggttgctcagacttttctctcaaagatttcacagaatgt
gataaagaaggaattgacaatttcgctcttgattccgaagatacagacattatcatccca
attatacagcaaattctcaagattaacccttctgttaaaattattgcaactccttggact
cctcctatttggatgaaggtttcagacctgtccacccttagaagacataattccttcatt
tctggttaccttgatccaagactttaccaagaatatgctacttattttgtcaaatacgtc
caagcaatggccaaatacaattttcacatctacgccatcacattacaaaatgagccactt
aataaaggcaactccgcttcttgtttcatgggctacgagccaacaaagagattttattaa

KEGG   Trichomonas vaginalis: TVAG_556910
Entry
TVAG_556910       CDS       T01022                                 

Definition
(RefSeq) glucosylceramidase precursor
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00600  Sphingolipid metabolism
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    TVAG_556910
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_556910
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TVAG_556910
SSDB
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydr_30_2
Other DBs
NCBI-GeneID: 4730872
NCBI-ProteinID: XP_001286410
UniProt: A2HAT7
LinkDB
AA seq 226 aa
MSNLGPHREGFRGLPNADNVYAYTTTGDQSKLFEPSVISFNKVSGNNPTVVINPDSKFQT
IDGFGAAITGSTAYNLKQMTQEARDKFLKDTFDPDTGMGYSFIRISIGCSDFSLKDFTEC
DKEGIDNFALDSEDTDIIIPIIQQILKINPSVKIIATPWTPPIWMKVSDLSTLRRHNSFI
SGYLDPRLYQEYATYFVKYVQAMAKYNFHIYAITLQNEPLNKGNSR
NT seq 680 nt   +upstreamnt  +downstreamnt
atgtcaaatctaggtcctcatagggaaggatttcgtggattaccaaatgcagataatgtg
tatgcatatacaacaacaggcgatcaaagcaaacttttcgaaccatctgtaatttcattt
aataaagtttctggcaataatccaacagttgtcatcaatcctgattcaaagttccaaacg
atcgatggatttggagctgctattacaggttccacagcatataacttaaaacaaatgact
caagaagcaagagacaagttccttaaagatacattcgatccagacacaggtatgggctat
tctttcattcgtatttctatcggttgctcagacttttctctcaaagatttcacagaatgt
gataaagaaggaattgacaatttcgctcttgattccgaagatacagacattatcatccca
attatacagcaaattctcaagattaacccttctgttaaaattattgcaactccttggact
cctcctatttggatgaaggtttcagacctgtccacccttagaagacataattccttcatt
tctggttaccttgatccaagactttaccaagaatatgctacttattttgtcaaatacgtc
caagcaatggccaaatacaattttcacatctacgccatcacattacaaaatgagccactt
aataaaggcaactcccgctt

KEGG   Trichomonas vaginalis: TVAG_593180
Entry
TVAG_593180       CDS       T01022                                 

Definition
(RefSeq) glucosylceramidase precursor
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00600  Sphingolipid metabolism
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    TVAG_593180
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_593180
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TVAG_593180
SSDB
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydr_30_2
Other DBs
NCBI-GeneID: 4723987
NCBI-ProteinID: XP_001279673
UniProt: A2HV24
LinkDB
AA seq 275 aa
MSNLGPHREGFRGLPNADNVYAYTTTGDQSKLFEPSVISFNKVSGNNPTVVINPDSKFQT
IDGFGAAITGSTAYNLKQMTQEARDKFLKDTFDPDTGMGYSFIRISIGCSDFSLKDFTEC
DKEGIDNFALDSEDTDIIIPIIQQILKINPSVKIIATPWTPPIWMKVSDLSTLRRHNSFI
SGYLDPRLYQEYATYFVKYVQAMAKYNFHIYAITLQNEPLNKGNSASCFMGYEQQRDFIK
TALGPQFAANNISTKIIIYDHNYNYDNIVTQEHYP
NT seq 825 nt   +upstreamnt  +downstreamnt
atgtcaaatctaggtcctcatagggaaggatttcgtggattaccaaatgcagataatgtg
tatgcatatacaacaacaggcgatcaaagcaaacttttcgaaccatctgtaatttcattt
aataaagtttctggcaataatccaacagttgtcatcaatcctgattcaaagttccaaacg
atcgatggatttggagctgctattacaggttccacagcatataacttaaaacaaatgact
caagaagcaagagacaagttccttaaagatacattcgatccagacacaggtatgggctat
tctttcattcgtatttctatcggttgctcagacttttctctcaaagatttcacagaatgt
gataaagaaggaattgacaatttcgctcttgattccgaagatacagacattatcatccca
attatacagcaaattctcaagattaacccttctgttaaaattattgcaactccttggact
cctcctatttggatgaaggtttcagacctgtccacccttagaagacataattccttcatt
tctggttaccttgatccaagactttaccaagaatatgctacttattttgtcaaatacgtc
caagcaatggccaaatacaattttcacatctacgccatcacattacaaaatgagccactt
aataaaggcaactccgcttcttgtttcatgggctacgagcaacaaagagattttattaag
acagctcttggtccacagttcgctgcaaacaacatttcgacaaagatcattatttacgac
cataattataactacgataacattgttactcaagaacattatcca

DBGET integrated database retrieval system