KEGG   Trichomonas vaginalis: TVAG_122500
Entry
TVAG_122500       CDS       T01022                                 

Definition
(RefSeq) SNARE domain containing protein
  KO
K08498  syntaxin 6
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_122500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_122500
Membrane trafficking [BR:tva04131]
 SNARE
  SNAP-25[C] (Qc)
   STX6
    TVAG_122500
SSDB
Motif
Pfam: Syntaxin-6_N DUF745 SNARE XhlA Metal_resist DUF16 DUF2207 Prominin DUF5113
Other DBs
NCBI-GeneID: 5463687
NCBI-ProteinID: XP_001579170
UniProt: A2DN07
LinkDB
AA seq 236 aa
MNQGEDPYFRFRDEVDEGISNCEQQTREWEVLRSSVQSQQRADWVKSEIQSKLEPIRKQI
IDLEKMNAMILANPSKFKNITQQEVDNRRAFISKSRGRISQIESHLASPPPDTPEMRAAA
KRDRVARAKIDDHQRAIDSEIQNQQVQLQRQDENLDMIGNEVAQIRVISNQIGDELRDQN
DRLDAVNDHMDRTDNKIETVTQKMQKLLSSKTTWLWVACFVLTILLAVIMFLAFTT
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaatcaaggagaagatccatacttcagatttcgtgatgaagtagatgaaggcatttcg
aactgtgagcagcaaacccgtgaatgggaagttctccgttcgagtgtacagagccagcaa
cgtgcagattgggtaaaaagcgaaatccagtcaaagcttgaaccaatcaggaaacaaatt
atcgacttagagaaaatgaatgcaatgattttagcaaatccatcaaaattcaaaaatatc
actcaacaagaagttgataatagacgcgcctttatttcaaagtcaagaggaagaatctcc
cagatcgagagtcatctcgcatctcctccaccagatactccagagatgagagcggctgca
aagagagatcgcgtcgcaagagctaaaattgacgaccatcaacgtgcaatcgattctgaa
attcaaaaccagcaagttcagttacagcgccaagatgaaaatcttgatatgatcggaaat
gaagttgctcaaattcgcgttatttctaatcaaattggagacgaacttcgtgatcagaac
gatcgtcttgatgcagtcaatgaccatatggatagaacagataacaaaatcgaaactgtt
actcagaaaatgcaaaaattgttgtctagtaagacaacatggctttgggtagcttgcttt
gttcttacaatccttctcgctgtaattatgttcctcgctttcactacgtaa

DBGET integrated database retrieval system