KEGG   Trichomonas vaginalis: TVAG_123030
Entry
TVAG_123030       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K01191  alpha-mannosidase [EC:3.2.1.24]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_123030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_123030
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     TVAG_123030
Membrane trafficking [BR:tva04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    TVAG_123030
SSDB
Motif
Pfam: Glyco_hydro_38C Glyco_hydro38C2
Other DBs
NCBI-GeneID: 5463743
NCBI-ProteinID: XP_001579223
UniProt: A2DN60
LinkDB
AA seq 376 aa
MKVQFNKYGGICSVIVNGREFISDSVPLFFIYEDRPLQWPAWDIQLYHKEMQDKSPVLLT
YSLSDKNQLIFTWQVPEISENSTAEPSIIRQLISFQGTTIDMKTEVKWTQHDKLLKYVLP
TTIRSRFARFGLQFGYIERETHKNTTWDFARFEVPGRWVDLSDATGGITMTSDMKGGYDV
HEGTMMMSLLKSPMSVDKWADFGNRRHVIRLDFHTDNFSSRSQMISDQLCNPKTFCQTQK
QVMTNVYKQFISCDEKKLLLTALKVSEDGEGVIARFVEPCGGWVKTNVKFNYLSQGEWTF
ALVSMKEVIQKVLPKVNGNSEIEIEAKPFQVISVLMKKSQQAPVIRTQTIQQQKPQQMSS
PSRFSTSSFQTIIGYP
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaaagttcaattcaataaatacggtgggatctgttctgtcattgtcaatggccgtgaa
ttcatttctgattctgttcctcttttcttcatttacgaagacagaccattgcaatggccc
gcatgggatatacagctctaccacaaagaaatgcaagacaagagtcctgttttacttact
tattcattgtcagacaagaaccagttgatctttacatggcaagttcctgagatctctgag
aattcaactgcagaaccaagtatcatcagacaattaatctcattccagggaacaacaatc
gatatgaagacagaagtgaagtggacacaacacgataaacttctcaaatatgttttgcca
acgactatcagatcaagatttgcaaggtttggcctccaatttggttacatcgagagagaa
actcataagaacacaacatgggactttgcgagattcgaagttccaggaagatgggttgat
ctaagtgatgcaacaggtggtatcacaatgacaagtgatatgaaaggcggttatgatgta
catgaaggaacaatgatgatgtcacttttgaagagtccaatgtctgttgacaaatgggct
gatttcggaaacagaagacatgtcattagacttgatttccacacagacaatttcagttca
agaagccaaatgatatccgatcaattatgcaatccaaagacattttgccagactcaaaag
caagttatgacaaatgtttacaaacaattcatctcatgtgatgaaaagaaattgctcttg
acagcgttgaaagtcagcgaagatggagaaggagtcatcgcaagattcgttgaaccttgc
ggaggatgggtaaagacaaatgtcaagtttaactatttatcacaaggagagtggacattc
gctttagtttcaatgaaggaagtcatccaaaaagttcttccaaaggtcaatggaaacagt
gaaattgaaatcgaagcgaaaccattccaagttatcagtgttttgatgaaaaagtcacaa
caagctcctgtaatcagaacacagacaattcagcagcagaaaccacagcaaatgtcttcc
ccatcaaggttttctacttctagtttccaaacaattattggatatccataa

DBGET integrated database retrieval system