KEGG   Trichomonas vaginalis: TVAG_182300
Entry
TVAG_182300       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K08490  syntaxin 5
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_182300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_182300
Membrane trafficking [BR:tva04131]
 SNARE
  Syntaxin (Qa)
   Stx-cisGolgi
    TVAG_182300
SSDB
Motif
Pfam: SNARE DHC_N1 DUF5660 Syntaxin-18_N Use1 RT_RNaseH PP_M1 Syntaxin
Other DBs
NCBI-GeneID: 5468551
NCBI-ProteinID: XP_001583980
UniProt: A2D8W8
LinkDB
AA seq 269 aa
MDRTKEFHKYLQGATVSITASPTKSRRLNPPSRQMQDFYNHSKEVNMRLEEAIKFVNELD
GLVNTDNILNENDPKIQRLINTLGEEFKYIQTQIDALESTPSTNGQAKAVAVTLRRQLKN
TMNIFKQSVNKTTERVKATAERRKQNGYVRSASAQYTTSYNVDDEIEIPINQMQQVEMEH
LNERASLVRGVEQQTSAILQMFNDLSQIIADSNYNIVRIDENTMEALNNMKEGQSQMEKY
AEKVKNNKWFILKIFAVLFVFALIFILIV
NT seq 810 nt   +upstreamnt  +downstreamnt
atggataggaccaaagaatttcacaagtatttacaaggagcaactgtatcaataacagcg
agtcccactaagagtagaaggttaaaccctccttcgcgtcaaatgcaagacttttataat
cattcaaaagaagtcaacatgagacttgaagaagcaatcaaattcgtgaacgaacttgat
ggtttagtcaatactgataacatattaaacgaaaatgatccaaaaattcaaagacttatt
aacactttaggagaagaattcaaatacatccaaacgcaaatagatgctctcgaaagtact
ccgtcaactaacggacaagctaaagctgttgctgttacactaagaaggcagcttaaaaac
acaatgaatatctttaaacaatcagtaaataaaactacagaaagagtaaaagcgactgca
gagcgaagaaaacagaatggatatgtaagatcagcatctgcgcagtacacaacatcatat
aatgttgatgatgaaatagaaattccaattaatcagatgcaacaagtagaaatggaacat
ttaaacgaaagagcctcattagtacgtggtgtcgaacagcaaactagcgcgattttacag
atgtttaatgatttatctcaaattatcgcagatagtaactataatattgtaagaattgac
gagaatacgatggaagcattgaataatatgaaagaaggtcagtcccaaatggaaaaatac
gcagaaaaagtgaaaaataacaaatggtttattttgaagatatttgcagtattatttgta
tttgctctcatctttattttgattgtataa

KEGG   Trichomonas vaginalis: TVAG_318380
Entry
TVAG_318380       CDS       T01022                                 

Definition
(RefSeq) SNARE domain containing protein
  KO
K08490  syntaxin 5
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_318380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_318380
Membrane trafficking [BR:tva04131]
 SNARE
  Syntaxin (Qa)
   Stx-cisGolgi
    TVAG_318380
SSDB
Motif
Pfam: SNARE IKBKB_SDD Rx_N RPW8 DUF5471 ApoL DASH_Dad1 Taxilin Syntaxin_2 Fzo_mitofusin DUF1664 Ada3 Fez1 Allexi_40kDa
Other DBs
NCBI-GeneID: 4745900
NCBI-ProteinID: XP_001301177
UniProt: A2G3M4
LinkDB
AA seq 261 aa
MNRTSEFFTYLSQERPKNAQNNRSLRSKSKFFEFADSISTQITETSLICQRLDNLISGDN
VLGENDREIVELMNKLQNDIQQINKKIDSMQSMQKEAPQAPIVAQQLRKSLYDINTQFQS
IVDKRAQIMKENMSRRSRYGGYTHSQQVYNTSYNDDDEIEIPINQMQFEQQNLNERYGLV
KDVESSITSIVEMMTRLSTMIADQDTSIIRIDENTMEALTNMKAGESELMKYKDKVMKNK
WFILKIFIVLFIFALIFILIV
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaatagaacatcagaatttttcacatatctatctcaagagaggccaaaaaatgctcaa
aacaataggtcattaagatctaaatctaaatttttcgaatttgctgatagtattagtact
caaatcaccgaaacttcattaatttgtcaaaggctcgataacttgatatctggagataat
gttcttggtgaaaatgatagagaaatagttgaattaatgaataaacttcaaaatgacata
caacaaataaacaaaaagattgattcgatgcaaagcatgcaaaaagaagctccacaagca
ccaatagtagcacaacaacttagaaaatcgctttatgatataaatacgcaattccaaagt
attgttgataaaagagcccaaattatgaaagaaaacatgagtagaagaagtcgatatggt
ggatacacacactctcaacaggtttataatacatcttataacgatgatgacgaaatagaa
attccaattaaccaaatgcagttcgaacaacaaaatttaaacgagagatatggtttggtt
aaagatgttgaatcatctattacttcaattgttgaaatgatgacaagattatcaacaatg
attgctgatcaagatacatctattattagaatcgatgaaaatactatggaagccttaaca
aatatgaaagcaggtgaatcggaacttatgaaatacaaagataaagttatgaaaaataaa
tggttcatcttgaagatatttattgtcttgttcattttcgctcttatttttatccttatt
gtataa

DBGET integrated database retrieval system