KEGG   Trichomonas vaginalis: TVAG_188050
Entry
TVAG_188050       CDS       T01022                                 

Definition
(RefSeq) SNARE domain containing protein
  KO
K08489  syntaxin 16
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_188050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_188050
Membrane trafficking [BR:tva04131]
 SNARE
  Syntaxin (Qa)
   Stx-TGN / EE
    TVAG_188050
SSDB
Motif
Pfam: SNARE DUF5383
Other DBs
NCBI-GeneID: 4773761
NCBI-ProteinID: XP_001327977
UniProt: A2DV27
LinkDB
AA seq 274 aa
MWVTKQSGFRHILTDQFVSFRAANSASRGPRPTNCQENNYLIQTSEDLSTKFSFLNKKIE
ELEQLFIKRSKPTFDTNSIELIDHDIRLLTSDISSRISVLRNGIKKPIKTTDNDEAAILL
NLQQSQCARLAQVVSKFRNLQANRKGEAHIENDVDDPISAMYADFEPQLTPDQMTLLHRN
EEELRNQNDELARMVTMMNDLNEMFKDLSLLIFEQGTLLDRIDTKIEVAIQQVEKGNQQL
TDANNYQKSKCIYIYIATVCALIIICLFVIILKK
NT seq 825 nt   +upstreamnt  +downstreamnt
atgtgggtgacaaaacaaagtggatttcgccacattttaacagatcaatttgtatcattc
agagctgcaaattctgcatctcgtggccccaggcctacaaattgccaggaaaataactat
ttaatacaaacttcagaagatctttcaacaaaattttcatttcttaataaaaaaatcgaa
gaattagaacaactatttattaagagatcgaaaccaacatttgatactaattcaattgaa
ttaatcgatcacgatattcgattattaactagcgatatctcttccagaatatcagtatta
agaaatggtatcaaaaaaccgatcaaaacaacagataatgatgaagcagctattcttttg
aacttacaacaaagccaatgcgcgagattagcacaagttgtatcaaaattcagaaatcta
caagcaaatcgcaaaggagaagctcatattgaaaacgatgttgatgatccaatctctgca
atgtatgctgattttgaacctcaattaactcctgaccaaatgactttactacatagaaat
gaggaagaattgagaaaccaaaacgatgagcttgctagaatggtcacaatgatgaacgat
ctcaatgaaatgtttaaagatctttctctcttgatttttgagcaaggaacgctactcgat
agaattgacacaaagatagaggttgctattcaacaggttgagaagggaaatcagcaactt
acagacgccaataattatcaaaaatcgaaatgcatttacatctatatagctactgtttgt
gcattgattatcatctgcttgtttgtaattattttaaagaaataa

KEGG   Trichomonas vaginalis: TVAG_256730
Entry
TVAG_256730       CDS       T01022                                 

Definition
(RefSeq) syntaxin 16/TLG2-like protein
  KO
K08489  syntaxin 16
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_256730
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_256730
Membrane trafficking [BR:tva04131]
 SNARE
  Syntaxin (Qa)
   Stx-TGN / EE
    TVAG_256730
SSDB
Motif
Pfam: SNARE Use1 COG2 ETRAMP HTH_34 Fusion_gly Tho1_MOS11_C MRPL52
Other DBs
NCBI-GeneID: 4754306
NCBI-ProteinID: XP_001309463
UniProt: A2FEX9
LinkDB
AA seq 314 aa
MEKEQQMGYLRDRTAQYKTYRSGTAKSRGSYKSQLEDELNPTLAPEFGTSSNVVEKSNMV
ETKFNMIQMEIQNLADMHKQRKRIDFGNDRKLDLEIEAKTQQISTQIQQLRDAIRITDPN
LSKQSRTIQNNMQYGYSARLRDITIHFRDMQADYIKTIKKQKDRAARFEDDDNDDGVLDD
IDDVAFTDQQIAQVKSNENMLRQRNEELTNLIGMMNQLNQLFADLGTVLVEQGTMLDRID
GKVEEAAEEIKKGNVQLQKADHHQSSKCFYWYMIIVILLIIIFGGIIIGKKMKKSGGGSS
PTPVPNVTNIIKLL
NT seq 945 nt   +upstreamnt  +downstreamnt
atggagaaggaacaacagatgggttatttaagggacaggactgcccagtataagacatat
cgttctggtacagctaaatcgcgcggttcatataaaagccaacttgaagacgaattaaat
ccaacattggctccagaattcggaacttcatcgaacgttgttgaaaaatcaaatatggtt
gaaacaaaattcaatatgattcaaatggaaattcaaaatcttgcagatatgcacaaacaa
cgtaagagaatcgattttggaaatgatagaaagctcgatcttgaaatagaagcaaaaacc
caacaaatatctactcaaatccaacaattacgcgatgctattcgtattacagatccaaat
ctttcaaaacagagtcgaacaattcaaaataacatgcaatacggttattcagctcgttta
agagatataacaattcatttccgagatatgcaagccgattacatcaaaacaattaagaag
cagaaagacagagctgcaagatttgaagatgatgacaatgatgatggtgtacttgatgat
attgatgatgttgcttttacagaccaacaaattgctcaagtaaagagcaatgaaaacatg
ttacgtcagagaaatgaagaattaactaatttgatcggaatgatgaaccagctgaaccaa
ttgttcgctgatcttggtacagtgcttgttgagcagggtactatgcttgatagaattgat
ggaaaagttgaagaagctgctgaagagattaagaaaggaaatgttcaattacaaaaggct
gatcatcatcaatcatcaaaatgcttctattggtatatgatcatcgttattcttttgatt
attatttttggaggaattattattggaaaaaagatgaagaaatctggtggtggatcttcg
ccaacaccggttcctaatgttactaatataataaaactattatga

KEGG   Trichomonas vaginalis: TVAG_315270
Entry
TVAG_315270       CDS       T01022                                 

Definition
(RefSeq) syntaxin 16/TLG2-like protein
  KO
K08489  syntaxin 16
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_315270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_315270
Membrane trafficking [BR:tva04131]
 SNARE
  Syntaxin (Qa)
   Stx-TGN / EE
    TVAG_315270
SSDB
Motif
Pfam: SNARE Use1 COG2 HTH_34 ETRAMP Tho1_MOS11_C Fusion_gly
Other DBs
NCBI-GeneID: 4754802
NCBI-ProteinID: XP_001309955
UniProt: A2FDJ6
LinkDB
AA seq 321 aa
MEKEQQMGYLRDRTAQYKTYRSGTAKSRGSYKSQLEDELNPTLAPEFGTSSNVVEKSNMV
ETKFNMIQMEIQNLADMHKQRKRIDFGNDRKLDLEIEAKTQQISTQIQQLRDAIRITDPN
LSKQSRTIQNNMQYGYSARLRDITIHFRDMQADYIKTIKKQKERAARFEDDENDDGVLDD
IDDVAFTDSQIAQVKSNENMLRQRNEELTNLIGMMNQLNQLFADLGTVLVEQGTMLDRID
GKVEEAAEEIKKGNIQLQKADHHQSSKCFYWYMIIVILLIIIFGGIIIGKKMKKSGGGSS
PAPTPNVTNIIKLYGEKSSLA
NT seq 966 nt   +upstreamnt  +downstreamnt
atggagaaagaacaacaaatgggttatttaagggacaggactgcccaatataagacatat
cgttctggtacagctaaatcacgtggttcatataaaagccaacttgaagacgagttaaat
ccaacattagctccagaattcggaacttcatcgaacgttgttgaaaaatcaaatatggtt
gaaaccaaattcaatatgattcaaatggaaattcaaaatcttgcagatatgcacaaacaa
cgtaagagaatcgattttggaaatgatagaaagcttgatcttgaaatagaagcaaaaacc
caacaaatatcgactcaaatacaacaattacgtgatgctattcgtattacagatccaaat
ctttcaaaacagagtcgaacaattcaaaataacatgcaatacggttattcagctcgttta
agagatataacaattcatttccgagatatgcaagccgattacatcaaaacaattaagaag
cagaaagaaagagctgcaagatttgaagatgatgaaaatgatgatggtgtacttgatgat
attgatgatgtggcttttacagactcacaaattgctcaagtaaagagcaatgaaaacatg
ttacgtcaaagaaatgaagaattaacaaatttgatcggaatgatgaatcaattgaaccaa
ttattcgctgatcttggtaccgtgcttgttgagcagggtacgatgcttgatagaattgat
ggaaaagttgaagaagccgctgaagagattaagaaaggaaatattcagttgcaaaaggcc
gatcatcatcaatcatcaaagtgcttctattggtatatgattattgttattcttttgatt
attatttttggaggaattattattggaaaaaagatgaagaaatctggtggtggatcttcg
ccagcaccaactcctaatgttactaatataataaaactgtatggagaaaaatcttcacta
gcttag

KEGG   Trichomonas vaginalis: TVAG_316110
Entry
TVAG_316110       CDS       T01022                                 

Definition
(RefSeq) syntaxin 16/TLG2-like protein
  KO
K08489  syntaxin 16
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_316110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_316110
Membrane trafficking [BR:tva04131]
 SNARE
  Syntaxin (Qa)
   Stx-TGN / EE
    TVAG_316110
SSDB
Motif
Pfam: SNARE COG5 Use1 DUF5660 ETRAMP Prominin Glucos_trans_II Spc7 Syntaxin DUF4618 LPP T2SSF Allexi_40kDa MscS_porin
Other DBs
NCBI-GeneID: 4755730
NCBI-ProteinID: XP_001310876
UniProt: A2FAW9
LinkDB
AA seq 303 aa
MSTKDIQIGFIRDKTTQFRNFRGSMNFGSGPTNDVSTGLISATPMNDAKGRGDSTVINTA
SNIEAQFQNIQSEMKTLADMHKQRVKANFSDNKSQDAAIEAKTRSISTQITQLRDQIREG
SNHVNSTQAQIQENMKMGFVARLRDLTTRFRDMQAAYITNIRRMNEKAHAAVLDLGDAND
DEIGLDDFDPGLTGEQTSQIVANDLMLRQRNQELTQMIQSMNQLNELFADLGTLIIQQGT
MLDRIDNTIVEAHEQIQQGNKTLEKAETHQKSKCFYWYMIAVILLIIIFGTVVIIKKQKK
SSK
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcaactaaagatatacaaatcggctttattagagataagacaactcaattccgtaac
tttagaggctctatgaactttggttccggtccaacaaatgatgtttcaactggattaatt
agtgctacgccaatgaatgatgccaaaggacgtggagactctactgttattaacacagca
agtaatatcgaagcacagttccaaaacattcaaagtgagatgaagacattggcagatatg
cataaacagcgtgttaaagcaaacttttccgataataaatctcaagatgccgctattgaa
gccaaaacaagatcaatttctactcaaattactcagttacgcgatcaaattcgtgaagga
tcaaatcatgttaactctacacaagcccaaattcaagaaaatatgaagatgggctttgtc
gctagactacgtgatcttacaactagatttagagatatgcaagccgcatatattacaaat
attcgcagaatgaacgaaaaagctcatgcagccgttcttgatttaggagatgctaatgat
gatgaaattggccttgatgatttcgatccaggattaactggcgaacaaacttctcaaatt
gttgctaatgatttaatgctcagacagcgtaaccaagaattaacacaaatgattcaaagt
atgaaccagcttaatgaactttttgccgatcttggcactttaattattcaacaaggtaca
atgcttgatagaattgataatacgattgttgaggcccacgaacaaattcaacagggcaat
aaaaccctggaaaaggccgaaacacatcaaaagagcaagtgtttctattggtatatgatt
gcagttattcttctcattattatattcggtactgttgtcattattaagaagcaaaagaaa
tcttctaaataa

KEGG   Trichomonas vaginalis: TVAG_494270
Entry
TVAG_494270       CDS       T01022                                 

Definition
(RefSeq) SNARE domain containing protein
  KO
K08489  syntaxin 16
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_494270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_494270
Membrane trafficking [BR:tva04131]
 SNARE
  Syntaxin (Qa)
   Stx-TGN / EE
    TVAG_494270
SSDB
Motif
Pfam: SNARE Syntaxin CD34_antigen Serine_rich ALMT DUF2951 CD225 TMPIT DUF1664
Other DBs
NCBI-GeneID: 4775502
NCBI-ProteinID: XP_001329620
UniProt: A2DQ58
LinkDB
AA seq 288 aa
MFLGGYAGANKDITPDFLNARDGSTFRSGRVRNESSDTAQLLNHSYQPESPLDEIFKRSS
YIKKRMRECQSRIKELKPIQNKCLEQNFEIKTDLLANVSKSSQEISSILEDINNSLNALT
VYSSPQYPDREMIVKNIHHSLFDEYKKLNHKFKLQQTTFQTQYYSRESQKKNETNLLIDL
EGLYTGNDAPSQRTLETQQRQSNNELEELVRRAREVQQLFSDLATIIVEQGTIIDRIDYN
ISEALTNAQKGHEEVQEAEKYQKGSKMWICAIIMGILVFILFIAALFK
NT seq 867 nt   +upstreamnt  +downstreamnt
atgtttttaggaggttacgcaggtgcaaataaagatattacaccagattttctcaacgca
agagatggttccacgtttagatcaggtcgagtaaggaatgaatcctcagatacggcgcaa
ttactgaatcattcttatcaacctgagtcaccactggatgaaatcttcaagagatcgagc
tacatcaagaaaagaatgcgagaatgccaaagccgcattaaagaactgaaaccgattcaa
aataaatgtttagaacaaaattttgaaatcaaaaccgaccttttagcgaatgttagtaag
tcatctcaagaaatatcatcaatcttggaagatatcaacaacagtttaaacgctctgacg
gtatattcctctcctcagtacccagacagagaaatgatcgttaaaaacatacatcattct
ctctttgatgaatataagaaattaaatcacaagtttaaactgcaacaaacaactttccag
acacaatattacagtcgtgagtctcagaagaaaaatgagaccaatttattgatcgacctc
gaaggtctttatacaggaaatgatgcaccaagtcagagaacgctagaaacccaacaaaga
caaagtaataacgaattggaagaattagtacgaagagcaagggaagttcaacagcttttc
tctgatctagcaacaattatcgttgaacaaggaacaattattgatagaattgattataat
atttcagaagctttgacaaacgctcagaagggacacgaagaagtccaagaagcagaaaaa
taccaaaaaggatcgaagatgtggatttgcgcaattattatgggtattttagtatttatt
ctttttattgcagctttatttaagtaa

DBGET integrated database retrieval system