KEGG   Trichomonas vaginalis: TVAG_301370
Entry
TVAG_301370       CDS       T01022                                 

Definition
(RefSeq) BNR/Asp-box repeat family protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00600  Sphingolipid metabolism
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    TVAG_301370
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_301370
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     TVAG_301370
SSDB
Motif
Pfam: BNR_2
Other DBs
NCBI-GeneID: 4770082
NCBI-ProteinID: XP_001324343
UniProt: A2E5F9
LinkDB
AA seq 270 aa
MTWSDKKFIAAYESGKSCSDSSTILNTQTGEIVLFYNFMDYSAYGIYRQHVRFSSDDGET
WSDPIDITDQIAPPNSEKAFKFITSGKATQARNGNLYQTLVDVSIGKVYLIESKNGGRNW
TRIDIGVSPADETTVAALDTGNVLLNARTNQGCRYLFEIDPVNKVLVRSEKRTDLPDPTC
DASFMRYDYGKSSILFFANCHSNWGRKNMSIKYSLDNGRTFTGGKTVYPNNGGYSAITVA
PNTDIVYHYEYPDGNGLAVQVLPMDWGMDQ
NT seq 813 nt   +upstreamnt  +downstreamnt
atgacatggtctgataagaaatttattgcagcatatgaaagtggaaagtcctgttccgac
agttctacaattctaaatacgcaaacaggtgaaattgttcttttctacaacttcatggat
tattccgcatatggtatttacagacaacatgttagattctcaagtgatgatggtgaaaca
tggagtgatcctattgacatcacagaccaaattgctccaccaaattctgaaaaagccttc
aaattcattacatctggtaaggctactcaagctagaaacggcaatttataccaaacactt
gtcgatgtttcaataggaaaggtttatttaattgaatccaagaatggtggaagaaattgg
acaagaatcgatattggtgtttctccagctgacgaaacaacagttgctgcacttgacaca
ggtaatgtgttacttaacgcacgcacaaatcaaggctgtcgttacttatttgaaatagac
cctgtcaacaaggttcttgttaggtctgagaagaggacagatttaccagatccaacatgt
gatgcttcattcatgagatatgactatggaaaatcaagtattcttttcttcgcaaactgc
cactcaaattggggaagaaagaatatgtctatcaagtattcacttgataacggaagaact
ttcactggaggtaaaacagtctatccaaataatggaggttattctgcaataactgttgca
ccaaatacagacattgtctatcattatgaatacccagatggtaatggccttgccgttcaa
gtattgcctatggactggggaatggatcagtaa

DBGET integrated database retrieval system