KEGG   Trichomonas vaginalis: TVAG_363990
Entry
TVAG_363990       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K08506  syntaxin of plants SYP7
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_363990
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_363990
Membrane trafficking [BR:tva04131]
 SNARE
  SNAP-25[C] (Qc)
   Syp7
    TVAG_363990
SSDB
Motif
Pfam: SNARE COG5 SKA1 COG2 Baculo_PEP_C NPV_P10 BAR_2 Med9 eIF3_N Seryl_tRNA_N Laminin_II Syntaxin-6_N ZapB TMF_TATA_bd DUF1664 HAUS-augmin3 BLOC1_2 DUF3450 PMC2NT Sec8_exocyst RNase_P_pop3 DUF5798 Sec34 Spc7 COG6 HSBP1 LMBR1 Mistic
Other DBs
NCBI-GeneID: 4767100
NCBI-ProteinID: XP_001321407
UniProt: A2EDW8
LinkDB
AA seq 289 aa
MAELEKLLNRAKEMAKATGSADGKKDGEGDEELDEFTKLKNEICEMERQTRLDIKARDEF
AEAIGTRDQKAEIVKQTSQIRNKIKEMRNKVDQLRQMVADQEEQLRKKNKTSEGLQNRKK
LCDLCDARIDECERWAKGHSFVSAKDDPKKRALLKGANFDDTATPQLAHFVPSPTESEYE
EIAGIEDWRLQINKNEQEIDQKLDQLVEGTSALVHIANQLHDEYEILGRMTDEVDEKMDK
VDAKLESTNERVNALLEKVGGCSNCCIDIFLVLVILACLYFIASKFIKI
NT seq 870 nt   +upstreamnt  +downstreamnt
atggcggaacttgaaaagttactgaacagagccaaggagatggcaaaagccaccggatcg
gcagatggtaagaaagatggggaaggcgatgaggaattagatgaatttactaaacttaag
aacgaaatttgtgaaatggaacgccaaacccgtttagatatcaaagctcgtgatgaattt
gcagaagccattggtacacgtgatcaaaaagctgaaattgtaaaacaaacatctcaaatc
cgtaataagattaaagaaatgcgtaataaagttgatcaacttagacagatggttgctgac
caagaagagcaacttcgaaagaaaaacaaaactagcgaaggtttacaaaatcgtaagaaa
ctttgtgatctttgcgatgctagaattgatgaatgtgaacgttgggctaaaggtcactca
ttcgtcagtgcaaaggatgatccaaagaaacgtgctcttttgaaaggcgctaattttgat
gacacagcaactccacaacttgctcatttcgtaccatcaccaacagaatcagaatacgaa
gaaatcgctggtattgaagactggagattacaaatcaataaaaacgagcaagaaatcgac
caaaaattagaccaactcgtggaaggaacgtctgctctcgttcatatcgcaaaccagctt
cacgatgaatacgaaatcctcggtagaatgacagatgaagtcgatgagaaaatggataaa
gtcgatgcaaagcttgagtctacaaatgaaagagttaacgctctccttgaaaaagttggc
ggttgctctaactgctgcattgatattttccttgttcttgttattttggcttgcctttac
ttcattgcttccaaatttattaagatttaa

DBGET integrated database retrieval system