KEGG   Trichomonas vaginalis: TVAG_365600
Entry
TVAG_365600       CDS       T01022                                 

Definition
(RefSeq) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
tva  Trichomonas vaginalis
Pathway
tva00052  Galactose metabolism
tva00511  Other glycan degradation
tva00600  Sphingolipid metabolism
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TVAG_365600
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    TVAG_365600
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_365600
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TVAG_365600
SSDB
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2 Glyco_hydro_2_N Invasin_D3 Big_1 Glyco_hydro_42
Other DBs
NCBI-GeneID: 5465586
NCBI-ProteinID: XP_001581038
UniProt: A2DHK4
LinkDB
AA seq 804 aa
MHLMLAAFAAFSRSSDRTEIQFEKGWKFQRGDCADANKIDFDDHAWETVRVPHDWAIAGP
FDHHNDLQDVVVSQNFETEPSMKTGRTGGLPYVGAGWYRYYFKADATKNNTLLFDGAMSE
AHVYLNGELVCNWPYGYNSFFCDITDHVNKDGKDNVLAVRLQNHPQSSRWYPGAGIYRNV
HLITTNKIHVPVWGTHVTTPRAEADYSTMNLRTTLAGVNGETIKVVTKIFDPSGKEYMVN
DKYTQDGNDYVQDFTVNTPALWSPETPNVYTAQTTISANDVEVDTYPTTFGFRKVEFIKD
KGMFLNGVSRKFQGVCNHHDQGPLGTAVNDKAIHHQLEILKDMGADSIRTSHNMPAPELV
KACDEMGFMMIVEAFDEWDWAKCNNGYHRFFNEWAEKDIVNMVRHYRNHPSVILWSVGNE
IPNTCSNEALAVVKKLVSWCHREDSTRLVTCGTDQVQCSIYSGFAAALDIPGFNYRSFLY
QEAYEHLPQGYILGTETGSTVSSRGVYKLPAIKRATAIYPDHQSTGYDYEFCGWSNVPED
DFEMADDYEWTLGQFVWTGLDYLGEPTPYDTNGWPSHSSVFGIIDLAYIPKDRYYLFRTV
WNKKDHTLHMLPHWNWEGYEGQVVPVMVYSDYPQVELFINGASFGKMKRGNTSLQTRYRY
QWMNAVYQPGNIRAVAYDEHGNQVGSVQINTAGTPHHLKVETKHTSLKADGKDVAYITVS
VVDANGNLCPHDDREISFRVKGAGNFKGAANGNAASVDFFQRPRIHAFAGMLTAVVQTTE
EAGDIIFEASAKGLKSGTVTMTSK
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgcatctaatgcttgctgcttttgcagcattcagtagatcatcagatcgtacagaaata
cagttcgaaaaaggatggaaattccaaagaggtgactgcgcagacgcaaataaaattgac
tttgatgatcatgcttgggaaacagttcgtgttcctcacgattgggctattgctggtcca
ttcgatcatcacaatgacttgcaagatgtcgttgtctctcaaaactttgaaacagaacca
tcaatgaaaacaggccgtacaggtggtcttccatatgttggtgcaggctggtatagatac
tatttcaaggctgatgctacaaagaacaatacattattattcgatggtgcaatgagtgaa
gctcacgtttatcttaacggtgaactcgtttgcaactggccatacggttacaactctttc
ttctgcgatatcacagatcacgttaataaggatggcaaagataacgttctcgctgttcgc
ttacagaaccatcctcagtcctctcgctggtatccaggtgccggtatctaccgtaatgtt
catcttataaccacaaataagatccatgttccagtttggggcactcatgtcacaacacca
cgcgctgaagctgattattcaacaatgaatctccgtacaacacttgctggcgttaatggc
gagacaatcaaagttgtcacaaagatttttgatccatcaggcaaagaatacatggtaaat
gataagtacacacaggatggaaacgactatgtccaagatttcacagttaacacaccagct
ctttggtcaccagagacaccaaatgtttacacagcccagacaacaatttctgccaacgac
gttgaagttgatacatacccaacaacatttggcttccgcaaagtcgaattcatcaaggac
aagggcatgttcctcaatggtgtaagtcgcaaattccaaggtgtctgcaaccaccacgac
caaggtccattaggtacagcagttaatgacaaggcaatccaccatcaacttgagatcctc
aaggacatgggtgcagactcaatccgtacatctcacaacatgccagctccagaacttgtc
aaggcttgcgatgaaatgggcttcatgatgattgtcgaagctttcgatgagtgggattgg
gctaagtgcaacaatggctaccacagattcttcaatgaatgggctgaaaaagatatcgtt
aacatggttcgccactacagaaatcatccatctgttatcctttggtcagttggtaacgaa
attccaaacacatgctctaatgaagctctcgctgttgtcaagaaattagtttcatggtgc
caccgtgaagattcaacaagattagttacatgtggtacagatcaggttcagtgctccatc
tacagtggcttcgcagctgctttggatattccaggcttcaactacagatcattcctctac
caagaagcttatgaacaccttccacaaggctacatccttggtacagaaacaggctctact
gtttcatcaagaggtgtctacaaacttccagccatcaagcgtgctacagccatctatcca
gatcaccagtcaacaggttacgattacgaattctgcggctggtcaaacgtcccagaagat
gacttcgaaatggctgatgactacgagtggacacttggtcagttcgtttggacaggctta
gattatcttggtgaaccaacaccatatgatacaaacggatggccatcacactcatctgtc
tttggtatcatcgacttggcttacattccaaaggatagatactacttgttcagaacagtc
tggaacaagaaggaccacacactccacatgcttccacactggaactgggaaggctatgaa
ggacaggtcgttccagttatggtttactctgactacccacaggttgaattattcatcaat
ggtgctagcttcggcaagatgaagagaggcaacacatcactccagacaagatacagatac
cagtggatgaacgctgtctaccagccaggtaacatcagagctgttgcttatgatgaacat
ggcaaccaggttggatctgtccagatcaacactgctggtactcctcaccatctcaaggtt
gaaacaaagcacacaagtctcaaggctgatggcaaggatgttgcttacatcaccgttagc
gttgttgatgctaatggaaatctttgcccacatgatgatcgcgaaatttcattccgcgtt
aaaggagctggtaacttcaagggcgccgctaatggtaatgctgcttctgtcgacttcttc
cagcgtccacgcattcatgctttcgctggtatgctcacagctgtcgttcagacaactgag
gaagctggtgatatcatcttcgaggcttctgctaagggactcaagtcaggaacagttaca
atgacatcaaaataa

DBGET integrated database retrieval system