KEGG   Trichomonas vaginalis: TVAG_378530
Entry
TVAG_378530       CDS       T01022                                 

Definition
(RefSeq) SNARE domain containing protein
  KO
K08504  blocked early in transport 1
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_378530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_378530
Membrane trafficking [BR:tva04131]
 SNARE
  SNAP-25[C] (Qc)
   Bet1
    TVAG_378530
SSDB
Motif
Pfam: NPV_P10 Retrotrans_gag BAR_3 HSBP1 AI-2E_transport Med2 DUF16 RasGAP_C Dynamitin ZapB BLOC1_2 LPP Gp-FAR-1 SHE3 Stevor PPR_3 CoV_S2 DUF1664
Other DBs
NCBI-GeneID: 5467929
NCBI-ProteinID: XP_001583360
UniProt: A2DB44
LinkDB
AA seq 112 aa
MSRKTDPIFRGNKQADPENPLVDQFDDQVDTLQQTIGALKQVSNALGEELERHNTLLDQM
QNSFQKSEDLVNRLLSGVDEIFKKTGLSPTTLTFLFVLGVILFLWLYWKIFA
NT seq 339 nt   +upstreamnt  +downstreamnt
atgagtagaaaaaccgatccgatatttaggggtaataagcaagccgatccagagaatcca
ttggttgatcaatttgatgatcaggttgacaccttgcaacaaacaattggcgctttgaaa
caagtttctaacgcgttaggcgaagaactagaaagacacaacactttacttgatcaaatg
caaaattcattccaaaagagtgaagatcttgttaatagattgctctcaggagttgatgaa
attttcaagaaaacaggattaagccctacaactttgacatttctatttgttctcggagtt
atacttttcctttggctctattggaagatttttgcttaa

DBGET integrated database retrieval system