KEGG   Trichomonas vaginalis: TVAG_381070
Entry
TVAG_381070       CDS       T01022                                 

Definition
(RefSeq) Synaptobrevin family protein
  KO
K08517  vesicle transport protein SEC22
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
tva04145  Phagosome
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_381070
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    TVAG_381070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_381070
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    TVAG_381070
SSDB
Motif
Pfam: Synaptobrevin Longin
Other DBs
NCBI-GeneID: 4746668
NCBI-ProteinID: XP_001301928
UniProt: A2G1G3
LinkDB
AA seq 215 aa
MSVQFIHIRRLKDGLILASTTDDETSLQSIINEEEKLIKQISQRSAKTLSFPTSNGSIHI
CIDDQAYAVCSTSREFDTTMAYDLNDESLRNFMIDYKDSIDAVESKYAFMDFSTILDSIR
SRYVKTAANGKVYKLKKDLYEVESSMANNLKSAIARDDKINEVGQMSENLSRNSGIFAKK
SKDLNRLHFWRTYGRPAVIVSIVACVYLLVHFVIL
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtcagtccaattcattcatattcgtagacttaaagatggcttgattcttgcatcaaca
acagatgatgaaacatctctccaaagcataataaatgaagaggaaaagttaataaaacaa
atatcacaaagatctgcaaaaacattaagttttccaacatcaaatggatcaattcatatt
tgcattgatgatcaggcttatgctgtttgctcaacaagccgcgaattcgatacaactatg
gcctatgatctcaatgatgaatctttaaggaattttatgatagattacaaagattcaatc
gatgcagttgaatctaaatacgcttttatggacttttctacaattttagattcaatcaga
tctcgctacgtaaaaacagcagcaaatggaaaggtttataaactaaagaaagatttatac
gaagtagagtcatccatggctaacaatcttaagtcagcaatagctagagacgataaaatt
aatgaagttggccaaatgtctgaaaatctttcaagaaattccggaattttcgcgaaaaag
tcgaaagatctcaatagattacatttctggcgtacttatggaagacctgctgtcattgtc
tcaattgttgcctgtgtttatctacttgttcacttcgttattctctaa

DBGET integrated database retrieval system