KEGG   Trichomonas vaginalis: TVAG_432570
Entry
TVAG_432570       CDS       T01022                                 

Definition
(RefSeq) SNARE protein
  KO
K08516  synaptobrevin homolog YKT6
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_432570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_432570
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Ykt6
    TVAG_432570
SSDB
Motif
Pfam: Synaptobrevin Longin DUF16
Other DBs
NCBI-GeneID: 5465186
NCBI-ProteinID: XP_001580647
UniProt: A2DIP8
LinkDB
AA seq 190 aa
MKIYSLYLYQKGADGKMKLVDSANDFNDIGFLYRKNAIEICDFAAQQMADGSNMNTYITA
EENKFLISMYRMRPNVAILIAVDKEYPSRAAFNILREIGTEYETNHLQFPNGKSAVMKKA
IVEYQNPANADKIKKIQENLDDIQKIMVTNLEEAIGRGQKINELAEKSEHLSESSKMFLR
DSKKLNRCCG
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaagatctattctttgtatctctatcaaaaaggagctgatggaaaaatgaagctcgtt
gattctgccaatgatttcaacgatattggatttctttatcgcaagaatgccatcgaaatt
tgtgattttgccgcccaacaaatggccgacggctcaaatatgaacacatatatcaccgca
gaagagaacaagttcctcatctctatgtaccgtatgaggccaaatgttgcaattcttatc
gctgtcgataaagaatatccatcacgtgcagcattcaacattcttcgcgaaattggaacc
gaatacgaaacaaaccatttacaattccccaatggtaaatcagctgttatgaaaaaagcc
attgtagaatatcaaaacccagctaatgcggacaaaattaaaaagattcaagaaaacctt
gatgatattcagaaaattatggtcacaaaccttgaagaagccattggtcgtggccagaaa
attaatgaactcgctgagaagtccgaacatctttcagaatcatctaagatgttccttcgt
gactcaaagaagctcaatagatgctgcggataa

DBGET integrated database retrieval system