KEGG   Trichomonas vaginalis: TVAG_457250Help
Entry
TVAG_457250       CDS       T01022                                 

Definition
(RefSeq) glutamate decarboxylase beta
Organism
tva  Trichomonas vaginalis
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 5467643
NCBI-ProteinID: XP_001583076
UniProt: A2DC49
LinkDB All DBs
AA seq 457 aa AA seqDB search
MKGLIDSRFGSESIRLVAEKNVFPDSQMREDVAYQMIHDELYLDGNARQNLATFCQTWDD
KYVHKLMNKSINKNWIDKEEYPQSSQFDMRCIRMLADLYHAPLTKGQEAVGTNTIGSSEA
CMLGGMAMKWRWRKKREAEGKPTDKPNLVCGPVQVCWHKFARYWDVELRELPMEKGKYFM
DPKRMVEACDENTIGVVVTFGVTYTGNYEFPKEFNDALDQLQKEKGLDIDIHVDAASGGF
LAPFCAPDIKWDFSLPRVKSINTSGHKYGLAPLGCGWIIWRDQESLPEELVFKVDYLGGQ
VGTIAINFSRPAGQVIAQYYEFIRLGKEGYRKVHTASYQVAQFLAKRIAPLGPFEFICEG
DPKKGIPAVTFKIKDGQDPGYALYDISERLRLRGWQVPAFALADNCSDIVVMRIMCRRGF
EMDFADLFMKDFEACVEYLKANPSRARITEMKSFNHT
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtttgattgattctaggtttggatcagagtcaataagattggttgccgaaaag
aatgtgtttcctgattctcaaatgcgtgaagatgttgcctatcaaatgattcacgatgaa
ctttacttggatgggaacgcaaggcaaaatttagctacattttgccagacatgggatgac
aaatatgttcacaagcttatgaataaatcgataaataaaaattggattgataaagaagaa
tacccacaatcatctcagtttgatatgagatgcattagaatgcttgcagacttatatcat
gcaccattaacgaaaggacaagaggctgttggaaccaatacgattggttcttctgaagct
tgcatgcttggaggcatggcaatgaagtggagatggcgcaaaaagcgtgaggctgaagga
aaacctacagataaaccgaatttggtttgcggacctgttcaagtttgctggcataaattt
gccagatactgggatgtcgaactaagagaactaccgatggaaaaaggaaaatacttcatg
gatcctaagagaatggttgaggcctgcgacgaaaatactattggtgtagttgtaacattt
ggagttacctacaccggaaactacgaattcccaaaggaatttaacgatgctcttgaccaa
cttcaaaaggagaaaggattagatatcgatattcatgttgatgctgcaagtggcggcttc
ttagctccattttgtgctccagatatcaaatgggacttcagtttaccacgtgtgaaatca
attaatacgtctggccataaatatggtcttgctccattaggttgcggctggattatatgg
cgtgatcaagaatctcttccagaagagcttgtcttcaaagttgattacttaggtggtcag
gttggaaccatagctattaacttttcgcgcccagctggtcaagttattgcgcaatattac
gaattcatcagacttggcaaagaaggatacagaaaagtacacactgcttcataccaagtt
gcacaattccttgcgaagcgaattgctcctcttggcccgttcgaatttatttgtgagggc
gatccaaagaaaggaattcccgccgtaactttcaaaatcaaagatgggcaagatccagga
tacgctctctacgatatctctgagcgcctaagacttcgtggctggcaagttcctgctttt
gctttagctgataattgctcagacatcgttgtcatgagaattatgtgtcgccgtggattc
gaaatggatttcgccgatttgtttatgaaagattttgaagcatgcgttgaatatctcaaa
gcaaatccgtccagagcacgaatcactgaaatgaagagcttcaatcatacataa

DBGET integrated database retrieval system