KEGG   Trichophyton verrucosum: TRV_00221Help
Entry
TRV_00221         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
tve  Trichophyton verrucosum
Pathway
tve00770  Pantothenate and CoA biosynthesis
tve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TRV_00221
Enzymes [BR:tve01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     TRV_00221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP
Motif
Other DBs
NCBI-GeneID: 9581819
NCBI-ProteinID: XP_003025581
UniProt: D4CZH9
LinkDB All DBs
AA seq 401 aa AA seqDB search
MSQAAHIASSTQTLTPEEAESYYFKINPPPPSLQEHHDLAKEFIDRHVQTGRRLVLVTSG
GTTVPLETQTVRFVDNFSAGTRGATSAEYFLQEGYAVIFLHRQFSLLPYSRHFSHSTNCF
LDFMDEGASSSDSSGTNNNGDGPIIVRSEYQDEMRKVLRQYRYAKDNNLLLVLPFVTVTE
YLYELRSLANLMKPLGPNALFYLAAAVSDFFIPRDRMVEHKIQSSNEPVTNKEKSTEKAN
SDIDPDTIYTGFNDPKPPTHGKKLIIDLDPVPKFLHRLVDGWAPTGSMVVSFKLETDPDL
LISKSEQALQRYAHHMVIGNLLSTRKWEVVFVSRDKTTGKFGLEWVRVPKSTTRMRKGSV
AASGGTAQPQPEVEIESLIIPELKKAHTEMIETFRKSHESK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagcagctcatatagcttcatcaacgcagactctgaccccggaggaagccgag
tcttactactttaaaatcaatccgccacccccctcgttgcaggagcatcatgacctggca
aaggagttcatagatagacatgtccagacgggccgaagattggttctagtcacctccggg
ggaacaacagtaccccttgagacacagaccgtcagatttgtggataacttctctgctggt
acccgtggagctacttctgcagagtacttcttgcaagaaggatatgcagtgatcttctta
catcgacagttcagcttacttccatactcgagacatttcagccattcaaccaattgtttc
cttgattttatggatgaaggggcctcctcttctgattcttcaggcaccaataataatgga
gacggtcctattattgtccgatctgaataccaggatgaaatgcgcaaggttctgcgacag
taccgatatgcgaaggataacaacctcttacttgtccttcccttcgttacggtgacggaa
tacctgtatgaactccgatcacttgccaacctgatgaaacctctcgggcccaatgccctt
ttttatcttgccgctgccgtttccgacttctttatccctcgtgataggatggtagaacat
aagatccaatcatccaatgaaccggttaccaataaagagaagtcaacggaaaaggcgaat
tctgatattgatcccgacacgatctatactggattcaatgacccaaagcccccaacgcat
ggtaaaaagctaattatcgaccttgaccccgttcctaagttcttgcaccggctggttgat
ggctgggcaccgacaggcagtatggtggtcagtttcaagcttgagacagatcctgattta
cttatatcgaagtctgagcaagcgttacaacgatatgcacatcatatggttattggtaac
ctgctgtcaactcgaaaatgggaggttgtatttgtgagtcgggacaagacgaccggcaag
tttggattggagtgggttcgcgttccaaagtcaaccacgagaatgagaaaggggagcgtt
gctgctagtggaggcacggctcaaccccagcctgaagttgaaattgagagtttgattatt
ccggagttgaagaaggcgcatactgagatgattgaaacttttagaaaatcccacgaatcg
aagtag

DBGET integrated database retrieval system