KEGG   Trichophyton verrucosum: TRV_00712Help
Entry
TRV_00712         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
tve  Trichophyton verrucosum
Pathway
tve00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    TRV_00712
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tve03036]
    TRV_00712
Enzymes [BR:tve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     TRV_00712
Chromosome and associated proteins [BR:tve03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     TRV_00712
   HMT complexes
    COMPASS/SET1 complex
     TRV_00712
    COMPASS/SET1 complex (yeast)
     TRV_00712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET_assoc SET RRM_1
Motif
Other DBs
NCBI-GeneID: 9580611
NCBI-ProteinID: XP_003025054
UniProt: D4D0W6
LinkDB All DBs
AA seq 1376 aa AA seqDB search
KNDGEDTAWLYEKAAVLKDASSSSARYISLPPIMSRASAGFADFFPTAPSVLQKKRSSKA
AAGQDAGSRLKGRSAAADFFAEEHHHHHHDDGGQLLDDEEHAAGGEASSASSSSTAEQTE
TATPIDPYSAGSAGSTAAAAAANGGAVARVGSSSSTATESSSSAAATTTLNGMSACALTP
LTNTDSSPPRKSGSPMLSSSRLADSEQSSISTATSASASASAVEYEKYHHHQDHDHHAKA
VVASSRLPPPRGYKLVYDPDLDKRPPASRDKRRKPQYVAFGEGEPASDAAVAAAAEPELG
QNLDPVSPVVVSDPRRAIPNYTRGAASKQKTKYRPAPYTLKPWAYDPATSIGPGPPTQIV
VTGYDPLTTVAPISALFSSFGEIAEIDNRTDPTTGRFLGVCSITYKDTRSLRGGSPLTAA
QSARRAYLECKKEQRIGTRRIRVELDRNSAACNRIVAKLIALQKQEQLAVFEQQNSDAAA
SKKSDIPPPPPPLPLLPTGPKAETEPSSQSQSQPKDNVPPPTAPKGPSGKSSLHPALQLQ
PPDGPRAAPKPPSLVEETPILDQIKRDPYIFIAHCYVPVLSTTVPHLERRLKLYDWKSVR
CDNTGYYVLFENSRRGELECERCFRGCHMTALFTYVMNMECQQYGNPSYERSPSPERVKA
EQREKSEKARLKRETELDVEEEKRLRAENVDPTTEVVAIAIRELRDKLLEDIKTRIAAPA
LYDFLDPDRHRAKRQKLGIADPQGIKKPAFYLDTGLGESTTDSRNSPAPPGAQSKNVLAL
PRIRKARDFERNNSAFVDERRRRPTVRRREFRPLYHRLQQLHDEDDSDDEHQTSFTRDTE
DQESRPLSRLSSEADNDDDENLRGSLVPSVSGFGDSGLDSAGIKDELDDLDRELLGEPGD
YERVSKKRKRLSLELLEMEKRRKTVDELFGVDTSHLGQEPDDDLSALVDSQAQRLGKEKG
KKPKKKTKKQLLEEKKALKLAELQAAADQGLIPKVDDLDLAVTPIEGELDIEAKEEEYEE
EEEEDGYVKPEVEWGLSTTEPKPTVEDDEGIVLDLDGWQNIVKDTEDLRFLREALESTSL
QSEPDTPIITNVTAWAWNQKQIKAINSHGARGPVHSEIKIDGYYVPNPSGSARTDGRKRI
LESEKSKYLPHRIKVQKAREEREALAKSDPTAAADAARVIAAKTLSKSTLTSSRSNRVNN
RRLIADINAQKQALPTQSGEGDVLRFNQLKKRKKPVRFARSAIHNWGLYAEENITANDMI
IEYVGEKVRQQVADMRERRYLKSGIGSSYLFRIDENTVIDATKHGGIARFINHSCTPNCT
AKIIKVDGSKRIVIYALRDIERDEELTYDYKFEREWDSDDRIPCLCGSTGCKGFLN
NT seq 4131 nt NT seq  +upstreamnt  +downstreamnt
aagaacgacggcgaggacactgcatggctctatgagaaggctgccgtgctcaaggatgcg
tcttcgtcttctgctcgatacatatctctgcctcccatcatgtcacgcgcctccgccggc
tttgcagacttcttcccaacggcgccctcggtcctgcagaagaagcgcagcagcaaggcc
gctgccggccaggacgcgggcagcaggctcaagggcaggtcggccgccgcagacttcttc
gcggaggagcatcatcatcatcatcacgacgacggcggccagcttctggacgacgaggag
catgctgcgggaggggaggcctcatcagcatcctcctcttccaccgcagagcagacggag
acagctacgcccatcgatccctactctgctggttctgctggttctactgctgctgctgct
gctgcgaatggcggcgccgttgcgagagtaggctcctccagctcgacggccacagagtcc
tcctcctcggccgcggccaccacgacgctcaacggcatgtccgcctgcgccctcacgccc
ctgacaaacaccgactcctcgccgccgcgcaagtccggcagccccatgctctcttcctcg
cggctggccgactctgagcagtcttccatctccaccgctacctctgcctctgcctctgcc
tccgccgtggaatatgagaaataccaccatcaccaggaccatgaccaccatgccaaggcc
gtcgttgctagcagtaggctgcctcctcccaggggctacaagctcgtctacgacccggac
ctggacaagaggcctcctgcgtccagggacaagcgccggaaacctcagtacgtcgccttc
ggtgaaggtgagcccgcctcagacgctgccgtggccgccgctgctgaacccgagttgggc
cagaaccttgacccggtatcaccagtagtagtatcagacccccggagagctatcccaaac
tacacccgcggcgccgccagcaagcaaaagacaaagtacagaccggctccctacaccctc
aagccatgggcctacgatccagctacctctataggacccggaccgcccacccagatcgtc
gtcaccggctacgaccccctcaccaccgtggcccccatcagcgccctcttctctagcttc
ggcgagatcgcggagatagacaacagaacggatcccaccacgggccgcttcctcggtgtc
tgctccatcacctacaaggacaccaggtctctgcgtggcggctccccgctcacagctgcc
cagtcagcccggagagcgtacctcgagtgcaagaaggaacagcgcatcggtactcggcgc
atcagagtagagctcgaccggaactccgctgcttgcaaccgtatcgtcgcaaagctcatt
gctctgcagaagcaggaacagctggctgtctttgaacaacagaacagtgatgctgctgcg
tctaagaaatccgacattccccctcctcctccacctctacctctattacctaccgggcct
aaagcagaaaccgaaccatcatctcaatcacaatcacaaccaaaggataatgtaccgccc
cctacagcccccaagggaccatctggtaaatcctctctacacccggccctacagctccaa
ccaccagacggacctcgcgcggcaccaaaaccgccctctctcgtcgaagagacccccatc
ttagaccagatcaaacgagacccttacatcttcattgcacactgctacgttcccgtcctc
agcaccaccgtaccccatctagaacgacgcctgaagctatacgactggaagtccgtccga
tgcgacaacacaggttactatgtcttgttcgaaaactcccgtcgaggagagctcgagtgc
gaacgctgctttcggggctgccacatgactgctctgttcacctatgtcatgaacatggag
tgccagcagtacggcaacccatcctacgaacgaagtcccagccccgaacgagtcaaggcc
gagcagcgcgagaaatccgaaaaggcacggctcaagcgggagaccgagctggacgtggaa
gaggagaagcgtctacgggctgaaaacgtcgatccaaccactgaggtcgttgccattgcc
atccgtgagctcagggataagcttctggaagatatcaagactcgcattgcagctccggca
ctatacgactttctggatccggaccggcaccgcgcaaagagacagaagctaggcatcgct
gacccgcagggcatcaagaagccggctttctacctcgataccgggctgggagaaagcacc
acggactcacgaaacagtcctgcaccgcctggtgcgcagtcgaagaacgtcctcgcctta
ccgcgtatcagaaaagcgcgagactttgaacgcaacaactccgcctttgtcgacgaacgc
agacgccgtcccactgtgcgcaggagggagttcagaccgctctatcaccggcttcaacag
cttcatgacgaagatgactccgacgacgagcaccagacttccttcacccgcgataccgaa
gaccaggagtctcggccgctctcccgcctgtccagtgaggcagacaacgacgacgacgag
aatctacggggctcccttgtgcccagcgtgtctggctttggagactccggtctcgactcg
gctggtatcaaggatgagctggatgacctcgaccgtgaattgctcggagaaccaggtgac
tatgaacgtgtctcgaagaaacggaaacgactcagcctggagctgctggagatggagaag
cggcggaagacagtggacgaactattcggtgtcgatacgtctcatctcggccaggaacca
gacgacgacctgtctgctctcgttgactcgcaggcccaacgactcggcaaagaaaagggc
aagaaaccgaagaagaagaccaagaagcagctcctcgaggagaagaaggctctgaaactt
gctgagctccaggctgctgcggaccagggcctgattcccaaagttgacgatctcgatctc
gccgtcacgcctattgaaggggaacttgacatcgaggccaaggaggaagagtatgaggaa
gaagaggaggaagacggatacgtcaagccagaggttgaatggggattgtcaactaccgaa
cccaagcccacggtcgaagacgacgaaggcatcgttctcgatctcgacggatggcagaac
atagtcaaggacacagaagaccttcgattcctccgagaagctctagaatccacctcgctc
caatccgaacccgacacccccatcatcaccaacgtcacagcctgggcctggaaccagaaa
caaatcaaggccatcaacagccacggcgcccgcggtcccgtccactccgaaataaagata
gacggctactacgtccccaacccaagtggttccgcccgcaccgacggccgcaaacgtatc
ctcgagtccgaaaaatccaaatacctccctcaccgcatcaaggtccaaaaggcccgagaa
gaacgcgaagccctagccaaaagcgatcctaccgccgccgcagacgcagctcgagtcatc
gccgccaaaaccctctccaaatcaacccttacctcctcccgctccaaccgcgtcaacaac
cgccgtctaatagccgacatcaatgcgcagaaacaagctctgcccacccaaagcggcgag
ggagacgtgctgcgcttcaaccagctgaagaaacgcaagaagcccgtccgtttcgctcgc
tcggcaatccacaattggggtctgtatgccgaggaaaatatcactgcgaacgacatgatt
atcgaatacgttggtgagaaggtccggcagcaggtggctgatatgcgtgagcgacggtac
ctcaagtccggcattggaagcagttacttgtttcgcattgatgagaataccgtcatcgac
gctacgaagcatggtggcattgcgcgctttatcaatcatagctgcacgcccaactgcacg
gcgaagatcatcaaggtcgacggaagtaagcgtatcgtcatttatgcccttagggacatt
gagagagatgaggaattgacgtacgactacaagttcgagcgagagtgggatagcgatgac
cgtatcccgtgtctctgcggctcgacgggctgcaagggattcctcaattaa

DBGET integrated database retrieval system