KEGG   Trichophyton verrucosum: TRV_01433Help
Entry
TRV_01433         CDS       T01615                                 

Definition
(RefSeq) hexokinase, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tve  Trichophyton verrucosum
Pathway
tve00010  Glycolysis / Gluconeogenesis
tve00051  Fructose and mannose metabolism
tve00052  Galactose metabolism
tve00500  Starch and sucrose metabolism
tve00520  Amino sugar and nucleotide sugar metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01130  Biosynthesis of antibiotics
tve01200  Carbon metabolism
Module
tve_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tve_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRV_01433
   00051 Fructose and mannose metabolism
    TRV_01433
   00052 Galactose metabolism
    TRV_01433
   00500 Starch and sucrose metabolism
    TRV_01433
   00520 Amino sugar and nucleotide sugar metabolism
    TRV_01433
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TRV_01433
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tve04131]
    TRV_01433
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     TRV_01433
Membrane trafficking [BR:tve04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    TRV_01433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 9579506
NCBI-ProteinID: XP_003024367
UniProt: D4D2X7
LinkDB All DBs
AA seq 568 aa AA seqDB search
MYTSLSVVYDPLSSAPFLMSAVRLPVVFFASSSSSSSFAPPLSLLSNKSPTKAKTSPPLP
LPTTTTTTTTTATTANVIPISSYNIRPRDRSMVDMPKALLDEIKELEETFTVDTARLKKI
VDHFVNELTKGLSVEGGNIPMNVTWVLGFPTGNEQGTFLALDMGGTNLRVCEIVLSEEKG
EFDITQSKYRIPEELKTGTSEELWEYIADCVQQFIEYHHDGEELPDLPLGFTFSYPATQD
YIDHGVLQRWTKGFDIDGVEGEDVVPMLESALEKKGLSIKVAALINDTTGTLIASSYTDP
EMKIGCIFGTGVNAAYMDNAGSIPKIAHYNLPPDMPVAINCEYGAFDNERVVLPLTKFDK
IIDRDSPRPGQQAFEKMTAGLYLGEIFRLVLIDIIDNKGGIIFQGQKIDNLRKPYFLDSS
FLSAIEEDPFENLSETRDLFERVLGIQATKPELELCRRLAELIGTRAARISACGVAAICK
KKNIQSCHVGADGSVFNKYPHFKQRGAKALREILDWADNEDDKVIMSSAEDGSGVGAALI
AALTLERVKAGNLAGVRNKENISQMLKG
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtatacatctctctctgtagtctatgatccattatcttctgcgccttttttaatgtct
gctgtccgtctccctgtcgtcttctttgcttcttcttcttcctcctccagcttcgctccc
cctttgtctctgctgagtaacaaaagcccaaccaaggccaaaacctccccaccacttccg
ctgccaactacaactacaactacaaccactacagctacaactgccaacgtcatccccatc
tccagctacaacattcgacccagagacagatccatggtcgacatgcccaaggcgctgctg
gacgagatcaaggagctcgaagagaccttcacagtcgacacggccaggctcaagaagatt
gtcgaccacttcgtcaacgagctcactaagggcctcagcgttgagggcggcaatatcccg
atgaacgttacctgggtactcggattccctaccggcaatgaacagggtaccttcctggcc
ctcgacatgggtggcaccaacctgcgagtctgcgagattgtcctctctgaggagaaggga
gagttcgacatcacccagtcaaagtaccgtatccccgaggagctgaagactggaacctct
gaggagctctgggagtacattgccgactgtgtccagcagttcattgaataccaccacgac
ggagaggagctgccagacctcccactgggcttcaccttctcttaccccgcaacacaggac
tacatcgaccacggagtcctgcagagatggaccaagggattcgatatcgacggtgttgaa
ggagaggacgtcgtccccatgcttgagagtgcattggagaagaagggattgtctatcaaa
gtcgcagctttgatcaatgacactaccggaacgctgattgcttcctcatacaccgatcct
gagatgaagattggctgtatcttcggaactggtgtcaatgccgcatacatggacaacgcg
ggctcgatacccaagattgcccattacaacctgcccccagacatgcccgtcgccattaac
tgcgagtacggcgccttcgacaacgagcgtgttgtcctgcccctgaccaagttcgacaag
atcattgaccgtgactctcctcgtcccggccagcaggcatttgagaagatgaccgctggt
ctctacctaggtgaaatcttccgtctcgtcttgatcgatatcatcgacaacaagggcggc
attatcttccagggccagaagatcgacaatctccgaaagccatacttcctcgactcttcc
ttcctctctgccattgaggaggatccgttcgagaacttgtctgaaacccgcgacctgttc
gagcgtgtccttggaatccaggctaccaagccagagctcgaactgtgcagacgtctggcc
gaacttatcggcactagagctgcacgtatctctgcctgcggtgtagctgccatctgcaag
aagaagaacatccagtcctgccatgttggtgctgacggttctgtcttcaacaagtacccc
catttcaagcagcgaggtgccaaggcccttcgtgagatccttgactgggccgataacgag
gacgacaaggttatcatgagctccgccgaggacggttccggtgttggagctgctctcatt
gctgccctgaccctcgagcgtgtcaaggctggcaacttggctggtgtccggaacaaggag
aacataagccagatgctcaagggttag

DBGET integrated database retrieval system