KEGG   Trichophyton verrucosum: TRV_01507Help
Entry
TRV_01507         CDS       T01615                                 

Definition
(RefSeq) alpha-glucosidase AgdA, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
tve  Trichophyton verrucosum
Pathway
tve00052  Galactose metabolism
tve00500  Starch and sucrose metabolism
tve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TRV_01507
   00500 Starch and sucrose metabolism
    TRV_01507
Enzymes [BR:tve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     TRV_01507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 9579467
NCBI-ProteinID: XP_003024309
UniProt: D4D350
LinkDB All DBs
AA seq 826 aa AA seqDB search
MLATYIQCVLMGIIDERLHVIIEDSKEDVYQVPESVFPRPESEENDSASTKSALKFSMTQ
KPFSFKITRRATDEVIFDTSNSPLIFESQYLRLRTSLPDEPNLYGLGEHSDPLRLQTEDL
VTTLWNRDAFGIPPGTNLYGSHPVYYDHRGRSGTHGVFLLNSNGMDVKVGSENGDNGKKY
LEYNTLGGVLDFYFMAGPTPKEVASQYAEVVGLPAMMPYWGFGLHQCRYGYRDAFNVAEV
VYNYSQAGIPLETMWTDIDYMDGRKVFTLDSKRFPIDEMRALVKYLHDHNQHYIVMVDPA
VSYGDNDAFERGKTQDVFMKSRDGAIYKGELEALPLYLLYTKSSIGAVWPGVTAFPDWFH
PGTQDYWNNEFKLFFDPEKGIDIDALWIDMNEASNFCDWPCSDPEGWERDHDLPPAPPPV
RPIPRPLPGFPDKLQPGSVKLVKRDGTRLRSQAGLPGRDLIDPPYRIQNEAGSISNKTLN
TDLVHANGLVEYDTHNLYGTMLTIYRLGDNLSEWSQYRFSISQILQFAAIYQVPMVGADV
CGFGGNVTEELCARWAMLGAFYPFYRNHNDIAGRDQEFYRWESVTEAARTAIGIRYKLLD
YIYTAFHRQTQSGDPVLNPLFYIYPEDKDTFAIDLQFFYGDALLVSPVTDEGATSVEIYL
PDDIFYDYYTGEPVEGKGGLITMENVPITHIPLHFRGGQIVPMRADSANTTTELRKQPFE
LVICLDREGNAEGSLYLDDGDSLEQPHTSEINFEYHNGVLKVSGKFDFQNEEALEIKNIF
VLGYKQDMTVQDKGNKNKDSQYDERLKKLAIKAKILLTGPSEMTLH
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgttggctacctatatacaatgtgtgctaatgggaataatagatgaacggttgcatgtt
atcattgaagactctaaagaagacgtatatcaggtccctgagtctgtgtttcctcggcca
gagtctgaagagaatgacagtgcctcgacaaaatcagctctaaaattctccatgacccag
aagccattctccttcaagataaccaggcgagctactgatgaagtcatctttgatacatcc
aactctcccttgatctttgaatctcagtatctacgccttcgcacttctttgccagatgag
cccaacttgtacggactaggagagcacagtgaccctttacgtttacagacagaagatctt
gttactactctttggaatagagatgcctttggtattcctcctggcactaacttgtacggt
tcacacccggtctattatgaccatcgagggaggtcaggcactcatggtgtttttctcttg
aactccaatggcatggatgtcaaggtagggagtgagaatggtgacaatggaaaaaagtac
ctggaatataataccctaggaggcgtcttagacttttatttcatggctggaccgacgcca
aaggaggttgcttctcaatatgctgaagtggttggcctgcccgccatgatgccctattgg
gggtttggacttcatcaatgccggtatggctaccgggacgcttttaatgttgccgaggtg
gtctacaactatagccaggctggtatacccttggaaactatgtggacagatatcgactac
atggacggacgcaaagtcttcacactggactcgaagcgcttccccatagatgagatgaga
gccctagtaaagtacctccacgatcacaaccagcattatattgtcatggtagatccagca
gtgagctacggcgacaatgacgcctttgagagagggaaaacgcaagacgtgtttatgaaa
tccagggacggagcaatctataaaggtgagttagaggctctacccctttatttactctat
actaagtcatctataggcgccgtctggcctggtgtcactgcctttcctgattggtttcat
cccgggactcaagattactggaataatgagttcaaactatttttcgaccctgaaaaagga
atagacatcgatgctctctggatagatatgaacgaggcttccaatttctgcgattggccg
tgttctgaccctgaagggtgggaaagagaccatgatctaccaccagctcctccaccagtc
agaccaatcccaagaccgctacctggattcccggataaactccagcctggtagcgttaag
cttgtcaagcgcgatggaaccagattaagaagccaagctggcttgccaggtcgtgatctt
attgatccgccttacaggatccagaacgaagctggatctatcagcaacaagaccttgaat
actgacctggttcatgccaacggtttggttgagtatgatactcataacctttacggcact
atgctaaccatatacaggcttggtgataacctcagtgaatggagccagtaccggttttca
atttcccagatccttcaatttgcagctatataccaggttcccatggtaggagctgacgta
tgcggctttggaggtaacgtcacggaagaattatgtgctagatgggctatgctaggcgcc
ttttacccattttataggaatcacaacgatattgctggccgagaccaggaattttaccgc
tgggagtccgtaaccgaggcagcaaggactgccattggaatcagatataaactccttgac
tacatctacactgctttccaccgtcaaacacagtctggagaccccgttttgaacccactc
ttctacatctacccggaggacaaagatacctttgcaatcgacctacagttcttctacggc
gatgcattgttggttagtccggtaacggacgaaggtgccaccagtgttgaaatatatctt
cctgatgatatcttctatgattactatacaggggaacctgttgaaggaaaaggaggcctg
attacaatggagaatgttcccatcacgcacattccccttcacttccgcggcggacaaatt
gttccaatgcgcgccgacagtgccaatacaaccaccgagctacgaaaacagccattcgaa
cttgtcatctgcctcgaccgtgagggtaatgcagaaggtagcctctatctagatgatggt
gattcccttgagcaaccccatacatcagaaatcaactttgaataccacaacggagtcctc
aaagtctctggaaagttcgatttccaaaacgaggaagctttagagatcaaaaacatattt
gtcctggggtacaagcaggatatgactgtgcaagacaaagggaataagaacaaagattcc
cagtatgatgagaggttgaaaaagctggctatcaaagctaaaattttgcttacggggcct
tctgaaatgactcttcactag

DBGET integrated database retrieval system