KEGG   Trichophyton verrucosum: TRV_03656Help
Entry
TRV_03656         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
tve  Trichophyton verrucosum
Pathway
tve00730  Thiamine metabolism
tve00790  Folate biosynthesis
tve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    TRV_03656
   00790 Folate biosynthesis
    TRV_03656
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tve04147]
    TRV_03656
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tve00537]
    TRV_03656
Enzymes [BR:tve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TRV_03656
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRV_03656
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tve00537]
 Enzymes
  TRV_03656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 9576855
NCBI-ProteinID: XP_003022253
UniProt: D4D966
LinkDB All DBs
AA seq 607 aa AA seqDB search
MASNDPRPSNDTDRNDEESTLLTGERVSRTINDDSRRSPNFWRQVGLFTWALVATAAVIV
LAIVYQHDHSLPQDPHRARHTGKRNMIFMVSDGMGPTSLSMTRSFRQHVDKLPIDDILTL
DKHHIGSSRTRSSSSLVTDSAAGATAFACGKKSYNGAISVLPDHSPCGTVLEAAKAAGYM
TGLVVTTRITDATPACFSSHVNIRGYEDLIAEHQLGEYPLGVQVDLMMGGGRCHFLPNST
SGSCRADDKDLVKLAQSKGFHYFDDRKGFDALKKGEAAKLPLLGLLAPTDIPYEIDRRYR
EKEFPSLEEMTRTALRTLSDATKDSEHGFFIMIEGSRIDHAGHGNDPAAQVHEVLTYDKA
FAAVLEFLENDSTPGVLVSTSDHETGGLAAARQLHESYPEYLWLPDALANATHSSEYLEP
KLNAYLEGQGHGQSREEKRKHIREKFIKPALGIVDTTDEEIDRLIDNTGRPAAYLFADLV
SRRAQIGWSTHGHSAADVSIFASSPHDALPLVGNHENTEVGGFIATYLDLDLDAITKKLK
GVKTKPSTSSEESASDYSWMGKPLDKNVIVDQLDTYHGDFKRRLRKRGPDEEPVHQGRSD
CGCGNHR
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacgaccctcgcccatcgaacgacacggaccgaaacgatgaagagtctacc
cttctgaccggggagcgggtcagccgtactatcaacgatgattcccgtcgtagccctaac
ttctggcgtcaagttggactctttacttgggctctcgtcgctactgctgccgttatcgtc
cttgcaatcgtctaccagcatgaccattccctgccccaagacccccatagagctaggcac
actgggaaacggaacatgatattcatggtatccgatggaatggggcctacgagcttgtct
atgactcgctctttcaggcagcatgttgacaagcttcctatcgacgatatcctgaccctg
gacaaacaccatatcggatcatccagaacgaggtcttccagcagcctggtgacagattca
gccgccggagccaccgccttcgcatgtgggaagaagagttataacggtgccatatcggtt
cttcctgaccactcaccctgtggaaccgtcttggaagctgctaaggcagcaggttacatg
accggtttggtcgtcactacacgaatcaccgatgccactcctgcctgcttctcttcccat
gtgaacattcgtggctatgaagatctgattgctgaacaccagcttggtgaataccctctc
ggtgtacaggttgatcttatgatgggtgggggtagatgccacttcctgcccaactctacc
tccgggtcttgtcgtgccgatgacaaggatttggtcaagcttgcgcagtctaagggcttc
cattactttgatgaccgcaaaggattcgatgctctgaagaaaggcgaagctgccaaactg
ccgttgctaggtctcctggccccaactgatattccttatgaaattgatcgacgataccgg
gagaaagagttcccgtctttggaggagatgaccagaactgccctcaggacacttagtgat
gccaccaaggatagcgagcatggtttcttcatcatgattgagggctcgagaattgatcat
gctggtcacggtaacgacccagctgctcaggtccatgaggttttgacatatgacaaggca
tttgcagctgttctagaattccttgaaaacgactctacccccggtgttctcgtcagcaca
tccgaccacgaaaccggtggtctggccgctgcaagacagctccatgaatcatacccagag
tacctctggcttcccgatgctcttgctaatgctactcattcctctgagtacctcgagccc
aagttgaacgcctacctagaaggacaaggtcatggccaatcccgagaggaaaagcgcaag
catattcgcgagaaattcatcaagcctgctctaggaatcgtcgacaccactgacgaggaa
attgatcgtctgatcgataacaccggcagacctgctgcgtatctttttgccgaccttgta
agtcgcagagcccagataggctggagcacccacggccactctgccgctgatgttagcatc
tttgcttcgtctcctcatgacgctctcccactggttggtaaccacgaaaacactgaagtg
ggcggattcatcgctacctaccttgaccttgacctagatgctatcactaaaaagttgaag
ggtgttaagactaagccctcaactagcagtgaagaatctgcatccgactactcttggatg
ggtaagccgcttgacaagaatgtgattgtcgaccagcttgatacctatcacggagacttc
aagcgtcgtctaagaaagagaggccctgatgaggagcctgtacatcaaggacgatcagat
tgtggttgtggcaatcatcgatag

DBGET integrated database retrieval system