KEGG   Trichophyton verrucosum: TRV_04649Help
Entry
TRV_04649         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
Organism
tve  Trichophyton verrucosum
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 9578062
NCBI-ProteinID: XP_003021217
UniProt: D4DBZ7
LinkDB All DBs
AA seq 644 aa AA seqDB search
MADTGPSKLSGPHDLRDQHATAPPTDPELESQLHSLNAVQSLASPVVDSLQQHQHQQQQQ
QQQTSGRGISSRGAFDADLNNAAEGHLPPAVRSAGHGLEQIEQMDQVDIAFPSDGMVLST
PHDARLSQHPDDVAGHQFVSPTNNDMQFSPFTQQHLPQNMIPHFQSPGQADMSQGGSSHA
GEGHFKNMKCIPNPPDLQKWREKLFNVEDTIVLSEEEFQTYFPHVDNVYSHRSTQRYKRK
PFISHYWDCRLKGRPPGTPKTHDPNKKKRKRTARERNLCDVKIKITEYFPGAINSSQDIP
SGFEQPSQASSPSDLLVVPGSSNSNLDGSQPFGVLTPSATLPPGHPGVAGARYYTIQRVN
GNGGNGRSDSVEGPHRHTLEESDRIKKNSVQRNLLKEEKDKKKSTTQQKSYHSRASGYAY
STVKKHAKESDLKLYGSCFCPFVQRVWIALEVKGIPYQYIEIDPYKQPDSLLEVNPRGLV
PAIRHGNWGCYESSVLLEYLEDLDIGKPLLPPGDPQLRAHCRLWADHINRHIIPCFYRLL
QEQDPGKQITITELLKDHISKLVNASHVHGPFFLGRGISFVDIHFAPWMLRLTRVLKPYR
AWPDPERGSRWAAWMEAVELDEHVMATTSADDLYLDSYQRYAGE
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaccgggccgagcaagctgtctggcccccacgacctgcgcgaccagcacgcg
acagcaccgcccaccgatccagagctcgagtcacagcttcacagtctcaatgccgtccag
tcgctcgcctcgccggttgtcgactcgttacagcagcatcagcatcagcagcagcagcaa
caacaacaaacatccggaagaggcatatcgtcacgaggggcgttcgacgcggatttgaac
aatgcagcagaaggacacctcccgccagcagtacgatctgccggtcatggcctggagcag
atcgagcagatggaccaggttgacatcgccttccctagtgacggcatggtgttgagcacg
ccgcatgatgccagactctcacagcacccggacgacgttgctggccatcaatttgtatcg
ccgacgaacaatgacatgcagttctcaccgtttacccagcaacacctgccacagaacatg
ataccccatttccagtccccaggtcaggcagacatgtctcaggggggcagcagtcacgcc
ggcgaaggccatttcaagaatatgaaatgcatacctaacccgccggacctccagaaatgg
agggagaagctgtttaacgtggaggacacgattgtcttgagcgaagaggagttccaaaca
tatttcccccatgtagataatgtctactcccaccggtccacccaaagatacaagcgcaaa
ccctttatatcccattactgggactgtcggctaaaaggacgcccaccagggaccccaaag
acccatgaccccaataagaagaagcgaaagagaaccgctcgagagcgtaatctatgcgac
gtcaagataaagatcacggaatactttcctggcgccataaatagctcccaggatattcct
tcggggttcgaacaaccttcccaggcttcttcaccgtctgatctcctggtagtacctggc
tcatcgaactcaaatctagacgggtctcagcctttcggcgtactaacacccagtgcaacc
ctgccaccaggccatcctggcgtggccggggctcgatattacacaattcaacgtgtaaat
gggaatggggggaatggaagatcagactccgtcgaaggcccacatcggcatacacttgaa
gaaagtgaccggatcaagaagaatagcgtgcagaggaacctactaaaggaggagaaggac
aagaagaagtcaactactcagcaaaaatcataccatagccgtgcatctggatatgcatac
tccactgtgaaaaaacatgcaaaggagagcgacttgaagctgtatggcagctgtttctgt
ccctttgtacagagggtatggattgccctcgaggtcaagggaataccatatcagtacatt
gaaatcgacccatacaagcaaccagactctctacttgaagtcaaccctcgtggcctggtg
ccagccattcgacatggaaactggggatgctatgaaagcagtgttcttcttgaatatctt
gaggatttagatattggtaaacccttgttacctccaggagatccacagcttcgtgcacat
tgccgtctatgggcagaccatataaaccgccatataataccctgcttttaccggctgctg
caagaacaagacccagggaagcaaattacgatcactgaactactaaaggaccatataagc
aaacttgtcaacgcctcacatgtccatgggccgttcttcctaggccgtggcatctcgttc
gttgatatccattttgctccatggatgctaaggctcacccgtgtattaaaaccctaccgt
gcgtggcctgatccggaaaggggcagcagatgggctgcgtggatggaagcagtggagtta
gatgaacatgttatggccactacgagcgccgatgatttatacttggatagctaccagaga
tatgcaggtgagtag

DBGET integrated database retrieval system