KEGG   Trichophyton verrucosum: TRV_04661Help
Entry
TRV_04661         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
tve  Trichophyton verrucosum
Pathway
tve00020  Citrate cycle (TCA cycle)
tve00310  Lysine degradation
tve00380  Tryptophan metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01130  Biosynthesis of antibiotics
tve01200  Carbon metabolism
Module
tve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRV_04661
  09105 Amino acid metabolism
   00310 Lysine degradation
    TRV_04661
   00380 Tryptophan metabolism
    TRV_04661
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     TRV_04661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 9578074
NCBI-ProteinID: XP_003021229
UniProt: D4DC09
LinkDB All DBs
AA seq 1050 aa AA seqDB search
MFRTTRAVTLKASGASSLLRQSYTRSICSGARSNLQLTARKPLGVVCARKAWEQTRGYAV
ATGETSKGVDPNDSFLQGNTANYIDEMYMAWKEDPQSVHVSWRTYFHNMEEGKMPISQAF
QPPPTIVPTPTGGVPQHMPGNAAGTNVSNHLKVQLLVRAYQARGHHKAKIDPLGIRGEAD
SFGYSKPKELELSHYGFTEKDLDEEFALGPGILPRFETETRKKMTLREIIDACEKIYCGS
FGVEYIHIPDRVPCDWIRDRIEIPQPYKYSVDEKRRILDRLIWSSSFEAFLATKFPNDKR
FGLEGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFSGSA
EPSDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRSIQHYNNDE
KEFNTAMGVLLHGDAAFAAQGIVYETMGFHSLPAYSTGGTIHIVVNNQIGFTTDPRFARS
TPYCSDIAKAIDAPVFHVNGDDVEALNHVCQLAADWRAQFKSDVVIDIVCYRKQGHNETD
QPAFTQPLMYKRIASQQSQIDKYVEKLLKEKTFTKEDIDEHKKWVWGMLNDSFERSKDYT
PTSREWLTSAWNGFKTPKELATEVLGHPPTGVEAETLQMIGAKLGSIPENFTPHRNLKRI
LANREKSIKEGQNIDWSTAEALAFGTLCKEGHHVRVSGQDVERGTFSQRHAVLHDQENES
TYTALQHISPDQGSFVISNSSLSEYGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCII
DQFIASGESKWVQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVYPAADKIDRQ
HQDCNMQIAYMTSPANLFHILRRQINRQFRKPLIIFFSKSLLRHPSCRSSIEEFTGDSHF
RWIIPDDQHGKQIDEPEKIERVIMCSGQVWAALTKHREANGIRNTAITRIEQMHPFPWQQ
LKENLDSYPNAKDIVFCQEEPLNAGSWSYMQPRIETLLNETVHHNRRHVLYAGRNPSASV
ATGLKSSHIKEEQDLLHDAFTVHQEKLKGE
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaacaacaagagctgtgacgctgaaggcgtccggagcttcttcccttctccgg
caatcgtatactcgctcgatatgttctggagcaaggtcaaatcttcagctgacagcccgg
aaacctctgggtgttgtctgtgccagaaaagcctgggagcagaccaggggttacgccgtt
gcgactggcgagaccagcaaaggagtggacccaaatgactctttcctccagggcaacacc
gccaactacatcgatgagatgtacatggcctggaaggaggaccctcaaagcgtccacgtt
tcatggcgtacctacttccacaacatggaagagggtaagatgcccatctcgcaagccttc
cagcctccacccaccattgtccctactcctacaggcggtgtccctcagcatatgcctgga
aacgcagccggaacaaacgtctccaatcacttgaaggtccagcttcttgtccgcgcgtat
caggctcgtggacaccataaggcaaagattgaccctctcggcattcgcggggaggctgat
tcttttggatacagcaagccaaaggaactcgagctgtcccactatggcttcactgagaag
gaccttgacgaggaatttgctcttggcccaggaatcctccctcgcttcgagactgagacc
cgcaagaagatgactcttcgtgagattattgatgcctgcgaaaagatctactgtggctct
ttcggcgtggaatacatccacattcctgaccgcgttccttgtgactggatccgtgaccgt
attgaaattccccagccatacaagtactctgtcgatgagaagcgtcgcattctggaccgt
cttatctggagttccagcttcgaagcgtttttggccaccaaattccccaatgacaagcgc
ttcggtctggaaggctgtgagaccctggtacccggtatgaaggcattgattgaccgaagt
gtcgactacggtgtcaaggatattgttatcggtatgcctcaccgtggtcgattgaacgtc
ctcagcaacgtcgttcgtaagcccaatgagtctatcttcagtgagttcagcggtagcgcc
gaaccatctgatgagggctcaggtgatgtcaagtaccatcttggtatgaacttcgagcgc
ccaactccctctggaaagcgtgttcagctttcactcgttgccaacccctctcatttggaa
gccgaagacccagttgtccttggaaagactcgctccatccagcactacaacaatgacgaa
aaagaattcaacactgccatgggtgttcttcttcacggtgatgccgcattcgctgcccag
ggtatcgtttacgagaccatgggtttccattcgctacctgcctactccactggaggaacc
atccatattgtcgttaacaaccagatcggcttcaccactgacccccgttttgcccgatcc
accccttactgctctgatatcgccaaggccatcgatgctccagtcttccacgtgaacggt
gatgacgtcgaagctcttaaccacgtctgccagttggccgccgactggcgtgcccagttc
aagagtgatgttgtcattgacatcgtttgctaccgtaagcaaggccacaacgaaaccgat
cagcccgcctttactcagcctcttatgtacaagcgcattgcctcccaacagagccagatc
gataagtacgttgagaagctcctaaaggagaagacattcaccaaggaggatattgatgaa
cacaagaaatgggtctggggaatgctcaacgacagcttcgagcgcagcaaagactacacc
ccaaccagtcgagagtggctcacttccgcctggaacggattcaagacccccaaggagctt
gccactgaggtcctcggtcaccctcctactggcgttgaagcagagaccctccagatgatt
ggtgctaagcttggaagcattcctgagaactttactccacaccgcaacctaaagcgtatc
ttggccaaccgggagaaatccattaaggaaggccaaaatatcgactggtccactgctgaa
gctcttgctttcggtaccttgtgtaaggagggccaccacgtccgcgtttctggccaggat
gttgagcgtggcacgttctctcagcgtcacgccgtcctccacgaccaagagaacgagagc
acatacactgctctccagcacatcagccccgaccaaggatcctttgtcatttccaactcc
tccctcagtgaatatggagctctcggcttcgaatacggttactcgctaacctctcctaac
gctcttgtcatgtgggaagctcagttcggtgacttcgccaacaacgcccaatgtatcatt
gatcagttcattgcctccggtgaatcgaaatgggttcagcgatctggtctcgtcatgtct
ttgccccatggatatgatggccagggccctgagcactcttccggcagactggaacgttac
ctccagctttgcaacgaggatcctcgcgtttacccagccgccgacaagattgacagacaa
catcaggactgcaacatgcagattgcctacatgacctcccccgccaacttgttccacatc
ctccgtcgacagatcaaccgtcaattccgaaaaccattgatcattttcttctcgaaatcc
cttctccgtcacccaagctgccgatcctccatcgaggagttcactggcgattcccatttc
cgctggattatccccgatgaccaacatggcaaacagattgatgagcctgagaaaatcgag
cgtgtgattatgtgctccggtcaagtttgggctgccctcaccaagcaccgtgaggccaac
ggtatcaggaacactgccatcacccgtatcgaacaaatgcaccccttcccctggcaacag
ctgaaggagaacctcgacagctaccccaatgccaaggacattgtcttctgtcaagaggag
cctctcaacgccggaagctggagctacatgcagccccgcattgagacccttctcaacgag
actgtccaccacaacaggcgccatgtcctgtacgccggtcgtaacccaagcgctagtgtg
gccactggcttgaagagcagtcacatcaaggaagagcaagatctattgcacgacgctttc
accgttcaccaggaaaagctcaagggcgagtag

DBGET integrated database retrieval system