KEGG   Trichophyton verrucosum: TRV_04812Help
Entry
TRV_04812         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tve  Trichophyton verrucosum
Pathway
tve00020  Citrate cycle (TCA cycle)
tve00190  Oxidative phosphorylation
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01130  Biosynthesis of antibiotics
tve01200  Carbon metabolism
Module
tve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tve_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRV_04812
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TRV_04812
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TRV_04812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 9576746
NCBI-ProteinID: XP_003021099
UniProt: D4DCF9
LinkDB All DBs
AA seq 648 aa AA seqDB search
MSFSGLRSIAPTRQVCGIIYIYWGLCEELTDFAARIVASQPLRAKEASPFVSQKYPVIDH
EFDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHKDDWR
WHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGRIYQRAFGGQSQDY
GKGGQAYRCCAAADRTGHALLHTLYGQSLRHNANYFIEYFAMDLLMEDGECKGIIAYNQE
DGTLHRFRSHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGI
YGAGCLITEGSRGEGGYLLNSNGERFMEKYAPTAKDLASRDVVSRSMTMEIREGRGVGPD
KDHIYLQLSHLPAEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGE
VLTLDENGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTVRDNASPGA
PHKEISADAGAESIAALDKIRTADGSKSTFEIRNAMQRTMQSDVSVFRTQESLDEGVTKI
TEVDQMFADVNIKDRSMIWNSDLVETMELRNLLTCATQTAVAAANRKESRGAHAREDYPE
RDDVNWMKHTLTFQKQPHGKIDLTYRAVNGQTLDEAECKAVPPFKRTY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagtggtctacggagcattgctccaactcgtcaggtatgtggcatcatctac
atatattggggcttatgtgaggaattgaccgattttgcagctcgaatcgtcgccagccaa
cctctacgcgcaaaggaagcctctcccttcgtttcacaaaagtaccccgtcattgaccat
gaattcgatgccgttgtcgttggtgctggtggtgccggtctgagagccgccttcggcctt
gcggaggctggattcaacaccgcgtgtgttaccaaacttttccccacgagaagtcacact
gttgctgctcagggaggtataaatgcggctcttggaaacatgcacaaggacgactggaga
tggcacatgtacgatactgttaagggttccgactggcttggtgaccaagatgctatccat
tacatgacgagagaggccccccagagtgttatcgaactcgagggctacggatgtcctttc
tcgcgaactgaggacggacgtatctaccagcgtgctttcggtggacaatcgcaagattac
ggaaagggaggtcaggcttacagatgctgcgcagctgctgacagaaccggccatgctctc
ctccacaccctctacggtcaatctctccgccacaatgccaactacttcatcgagtacttc
gccatggatctcttgatggaggatggtgaatgtaagggaattatcgcctacaaccaggag
gacggtactcttcacagattccgctctcaccacactgtccttgctaccggtggatatgga
cgtgcctacttcagctgtacctctgctcacacttgcactggtgacggtatggctatggtt
gctcgtgctggacttcccaaccaggatctggaattcgtgcaattccaccctactggtatc
tacggtgctggttgtctgattactgagggttcccgtggtgagggtggctatcttcttaac
tcaaacggtgaacgattcatggagaagtatgccccaactgctaaggatttggcctctcgt
gatgtcgtctcccgatccatgaccatggaaatccgcgagggccgtggtgttggcccagac
aaggaccacatctacctccagctgagccatcttcccgccgaaattctccacgagcgactc
cccggtatctctgagactgcttctatcttcgccggtgttgatgttaccaagcagccaatt
cccgttctcccaactgtccactacaacatgggtggtatcccaaccaagtacactggtgag
gtcctcactctcgacgagaacggaaacgacaaagttgttcccggtttgtatgcctgcggt
gaagccgcgtgtgtctctgtccacggtgccaaccgtcttggagccaactccctcctcgat
cttatcgtcttcggccgtgctgtgtctcacaccgtcagggacaacgcctcccccggtgcc
ccacacaaggagatcagcgctgatgccggtgctgagtctattgctgctttggacaagatc
agaactgccgatggatccaagtctaccttcgagattagaaatgctatgcagaggactatg
cagtctgatgttagtgttttccgaactcaagagagtttggatgagggtgttaccaagatc
actgaggttgatcaaatgtttgccgatgttaacatcaaggaccgcagcatgatctggaac
tctgacttggttgagaccatggaactgaggaacttgttgacttgcgctacccaaaccgct
gttgctgccgccaaccgcaaggaatctcgtggtgctcacgcccgtgaagattaccctgag
cgagacgacgtcaactggatgaagcacactcttaccttccagaagcaaccccacggtaag
attgatctcacataccgtgctgttaacggacaaactctcgacgaggccgagtgcaaggct
gtcccaccattcaagcgtacatactag

DBGET integrated database retrieval system