KEGG   Trichophyton verrucosum: TRV_04981Help
Entry
TRV_04981         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K17863  linoleate 8R-lipoxygenase / 9,12-octadecadienoate 8-hydroperoxide 8R-isomerase [EC:1.13.11.60 5.4.4.5]
Organism
tve  Trichophyton verrucosum
Pathway
tve00591  Linoleic acid metabolism
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    TRV_04981
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.60  linoleate 8R-lipoxygenase
     TRV_04981
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.5  9,12-octadecadienoate 8-hydroperoxide 8R-isomerase
     TRV_04981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 9577726
NCBI-ProteinID: XP_003020905
UniProt: D4DCX5
LinkDB All DBs
AA seq 922 aa AA seqDB search
MGDVGDHLTLREEIEKGVSDVTRAISASLRPLPVASGDGTYLPTMHTTGILDDLARMKLG
DAGTLAEVAKLAATGQPIDDKRYIMERIIQLAASLPSTSKDGSALTEDLLSQLWNDLQHP
PLTTYSARVLGLLGRGMQRLFSQNLYNRSTFQTRGFFLIRSWPERDLNHTLARSLVCYSI
SLQSSFMIFLIPSKDLFKTDPRNPTVSKTSSYLDLSPLYGSNQAEQDSVRTFRDGKLKPD
SFAERRVHGLPPGSGLLLVMFNRFHNYVVRNLAAINEGGRFSKPQDGDAKAFAKYDNDLF
QTGRLITCGLYINCILKDYVRTILNINRIDSDWSLDPRAENAKPFLGSPIASATGNQVSV
EFNLIYRWHACISERDVKWSESIFRKIFPGRNPETIPMEEFLRNLGKFSSNLPDDPQERG
LGHLKRGPDGLFNDDELVQMLTEGIEDCAGAFGAKGVPKLLRPVEILGIMQARSWNLATL
NEFRKHFHLKPHETFEDINSDPYIADQLRHLYDHPDNVELYPGVVVEEVKEVMIPGSGLC
PNFTISRAILSDAVALVRGDRFYTTDYTPKALTNWGLNECNYDLKVNKGHVFHKLIFRAF
PHHFKRNSVYAHFPFVNPWENSKILSDLGIARKYSWDKPGRMNPPVMVNSHSACRTVLGN
KRDFKVTWGETIEYLMKRDGHPFGKDFMLSGDRPANSVSRRILHDALYIDRWREEVRVFY
KDTTIKLLHSKAYKLGGTINQVDIVRDVINMAHVHFCAAVFSLPLKTEENPRGVYTEKEL
YDIMALVFKCIFCDTDPAKSFALHEAARENSQTLGLLVMTNVELIKRTGFLAPLIDRIDR
HDNILADYGIHMIQRLLDTGLPPQDIVWSHLLPTAGGMVANQGQLSSQCLDYYLSKEGSV
HLPEIRRLSKLDTPEADDILLR
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgttggtgaccacctgactctccgagaggagattgaaaagggcgtttcagat
gttactagagctatcagtgcttccttgcgcccactacctgttgcgtccggggatggaacc
tatcttccaacgatgcatacaacgggtattttggatgaccttgcccgcatgaaactaggg
gatgcagggacactcgcagaagttgctaaactagccgcgactggccaaccaattgatgat
aagcgttatatcatggagaggattatccagctggcagcatccctacctagcacgtctaaa
gatggcagcgcgttaacagaagacttgctctctcaactatggaatgatttacagcacccc
ccactcacaacatattccgcccgggtgttggggctgctgggtcgaggtatgcaaagactg
ttcagccaaaatctgtacaaccggtcaaccttccagacccgggggttctttttgattcgc
tcatggcccgagagagatttgaaccacaccctagccagatctctagtatgctattctatc
tcgcttcaatcatcattcatgatatttctaataccatccaaagacttattcaaaactgat
ccacggaaccccaccgtttctaaaacatcgtcctatcttgatttatctcctttatatgga
tcaaatcaggcagagcaagacagtgtaagaaccttcagagatgggaagctgaagcctgac
agttttgccgaaagacgggtacatgggctcccccctggctctggactcttgcttgtgatg
ttcaatcgctttcacaactacgtggttcgcaacttggccgccatcaatgaaggtggtagg
ttttccaagcctcaggatggagatgcgaaggcatttgccaaatacgacaatgatcttttt
cagactggtcgtctgatcacctgtggattatatatcaactgcatcctgaaagactatgtg
cgaacaatccttaacatcaatcgtatcgatagcgattggagtcttgatccgcgagcagag
aatgcaaagccgttcctaggctccccaattgcctctgcaacaggaaaccaggtttccgtg
gaattcaatctcatctacagatggcatgcctgtatttcagagcgtgatgtcaaatggtcg
gaaagtatattccgcaagatatttccagggagaaaccctgaaaccatcccaatggaagag
tttcttcgaaatctgggaaaatttagctcgaatcttccggacgaccctcaagagcgggga
ttgggacaccttaaacgcggacctgacgggctgtttaacgacgatgaacttgttcagatg
ctgactgagggaatcgaggactgcgctggggcttttggtgccaagggcgtaccaaaactt
ttacggcccgttgagattctgggaattatgcaagcaaggtcatggaacttagcaaccctc
aatgaattcaggaaacatttccatctcaaaccgcacgagacattcgaagatatcaactcg
gacccatatattgctgaccagctgagacatctttacgatcatcccgataatgttgaactt
taccctggtgtcgtcgtcgaggaggtaaaagaagtaatgattccaggaagcgggctatgc
cccaatttcacaatctctcgtgctattctctcggatgcagttgcactcgttcgtggagac
cgcttttacaccactgattatactcctaaggcccttaccaactggggcttgaacgaatgc
aactatgaccttaaggtcaataagggacatgtattccacaaacttatcttcagggctttt
cctcatcatttcaaacgcaattctgtctacgctcatttcccattcgttaacccctgggaa
aattcgaaaatcctctctgacttgggtattgctcggaaatactcctgggacaagcctgga
cggatgaacccgcctgttatggtcaattctcactccgcctgccgaactgtccttggaaat
aagagggatttcaaagttacctggggtgaaaccatcgaatacttgatgaagcgagatggc
catccatttgggaaagacttcatgctttcaggggatcgtccggccaattcagtatctaga
aggatactgcatgacgccctctatattgatcgttggcgtgaagaagttagagttttctat
aaggatactacgataaaacttctccacagcaaggcatacaagttaggtggcactatcaac
caagtagatattgtccgtgatgttataaacatggcacacgttcatttctgcgctgcagtg
ttctctctgcccttgaagaccgaggagaacccgcgaggtgtttatactgaaaaggaactc
tatgacatcatggcacttgttttcaaatgcatattctgtgacactgaccctgcgaaaagt
tttgctcttcatgaggcagcgcgggagaactcccagactctgggtctacttgtgatgaca
aacgttgagctaatcaagaggacagggttcctggcgcctctgattgatcggattgatcga
catgacaatattctcgccgactatggaatacatatgattcagcggttgctggatacaggt
cttccacctcaggatatcgtctggtcacatctcttgcctactgctggcggtatggttgcg
aatcaagggcagctttcttcgcagtgccttgattactacctttctaaagaaggttctgtg
catctgccagagattcggaggctatcaaaacttgatactccagaggctgatgacatcctt
cttcgatag

DBGET integrated database retrieval system