KEGG   Trichophyton verrucosum: TRV_05045Help
Entry
TRV_05045         CDS       T01615                                 

Definition
(RefSeq) zinc-binding oxidoreductase, putative
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tve  Trichophyton verrucosum
Pathway
tve00500  Starch and sucrose metabolism
tve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRV_05045
Enzymes [BR:tve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     TRV_05045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 9577590
NCBI-ProteinID: XP_003020819
UniProt: D4DD38
LinkDB All DBs
AA seq 610 aa AA seqDB search
MRVTRLLWSSLVIPAAVGFQVRFKPSEDTALDTVDDGTLQSLLDNIGLNGSNAWDTRPGL
VIASPSKKDSNYFFTWTRDSALVLKCITDAFAAGNTALQETIHEYISSQARIQLLNTRSG
GLSSGGLGEPKYHVDETPYNEDWGRPQADGPALRATALIAYARWLLENDYYDVAKSIVWP
VVKNDLSYVSEHWNTTAFDLWEEVNSPSFFTTIVQHRALVEGINMARALDETCPHCESQA
PQALCYLQSYWTGSAVRSNYGQGRSGLDVASILGSIHTFDPEGECDDTTFQPCSARALAN
HKAVTDSFRSIYKINGGIKQGQAVAVGRYPEDVYFNGNPWYLATYAAAEQLYDAMYQWNK
IGKITVTDVSMPFFKDIYPEVQTGTHESSSPEFGNIIAAVKAYAEGYIEVAKKYTPCTGM
LSEQFSRDNGTPLSVADLTWSYASYLTVMARRNSVVPASWGEKNARDIPSTCVPSSATGP
YQTATITYWPPNLTPTAQPSPCPTALPTKNNVRFRLLATTQVGEDVFLVGSIPELGSWDV
KKAVPLNADIYADNCHQWYVDIELPTAVAFEYKFIRKRGGEVVWEQDPNRKYTVPQTCGV
SGAIKRDTWR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtaacccgtctgctatggtcttccctggttataccggctgctgtgggctttcag
gttcggtttaagccgtctgaggatactgctctcgacaccgtggacgatggcacactgcag
agcctgctcgataacatcgggttgaacggctcgaatgcctgggatacgaggccggggttg
gttatagctagtcctagcaaaaaggattcaaactacttctttacctggacgagagactcg
gctctagtgcttaagtgcattaccgacgcctttgcagctggaaataccgctctacaggag
acaatccacgaatacatctcatctcaagctcgcatccaattgctcaacacccgctctggt
ggtttgtcaagcggagggctcggagaaccgaaatatcatgtggacgaaaccccgtataat
gaggactggggccgacctcaggctgatgggcctgcgctaagagctactgccttgattgca
tacgcaagatggcttcttgaaaatgactactatgatgtagctaaatcgattgtttggccg
gttgtcaaaaatgacctttcatatgttagcgaacactggaacactactgcctttgatcta
tgggaggaagtaaatagtccatcctttttcaccactatcgtccaacaccgggctttggtg
gaaggtataaacatggcgcgtgcattggatgaaacctgccctcattgcgaatctcaggca
ccccaagcactctgctacttgcagtcgtactggactggatccgccgtccggtcgaactat
ggtcaaggtcgctccgggcttgatgtagcctctattctgggctctatccacacatttgac
cccgaaggagaatgtgacgacactaccttccaaccttgctctgcgcgagcattagcaaac
cacaaggcggtcacagattccttccggtccatctataagattaacggtggtatcaagcag
ggccaggccgtggccgtcggcaggtatcccgaagacgtatactttaatggaaacccatgg
tatctagctacttatgctgctgcagaacagctatacgatgccatgtatcagtggaacaag
ataggaaaaatcacggtgacagatgtttccatgccgttcttcaaggatatataccccgaa
gtgcagacagggacacacgagtcttccagcccggagttcggcaatataatagccgcagta
aaggcttatgcagaggggtatattgaagttgcaaaaaaatacaccccgtgcacaggaatg
ctttcagagcagttttccagagataatggaacaccactatctgtggcggatctcacttgg
tcatatgcatcgtatctaaccgtaatggcccgacgcaattccgtcgttccggcttcgtgg
ggagagaagaatgcccgagatatcccatctacttgtgtgccatcatcggcaaccgggcca
tatcaaacggctactataacctactggccaccaaacctcacccccaccgctcagccgtcg
ccctgccctacggccttgccaacaaagaacaatgtccgcttcagattgctcgctacgaca
caggtgggcgaagacgtcttcctggttggatctatcccagagctaggctcgtgggacgtc
aagaaggctgttccgctcaatgccgacatatatgcagacaactgtcaccaatggtatgtt
gacattgagcttccgactgccgtggctttcgagtacaagttcatccgcaagagaggagga
gaggtggtgtgggagcaggatccgaatcggaagtacactgtacctcagacctgcggcgtc
tcgggggcgattaagagagacacctggcgatag

DBGET integrated database retrieval system