KEGG   Trichophyton verrucosum: TRV_05913Help
Entry
TRV_05913         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tve  Trichophyton verrucosum
Pathway
tve03030  DNA replication
tve03410  Base excision repair
tve03420  Nucleotide excision repair
tve03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TRV_05913
   03410 Base excision repair
    TRV_05913
   03420 Nucleotide excision repair
    TRV_05913
   03430 Mismatch repair
    TRV_05913
Enzymes [BR:tve01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TRV_05913
    6.5.1.6  DNA ligase (ATP or NAD+)
     TRV_05913
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     TRV_05913
DNA replication proteins [BR:tve03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    TRV_05913
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     TRV_05913
DNA repair and recombination proteins [BR:tve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     TRV_05913
   NER (nucleotide excision repair)
    Other NER factors
     TRV_05913
   MMR (mismatch exicision repair)
    Other MMR factors
     TRV_05913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C MotA_ExbB
Motif
Other DBs
NCBI-GeneID: 9583799
NCBI-ProteinID: XP_003020049
UniProt: D4DFG3
LinkDB All DBs
AA seq 908 aa AA seqDB search
MAQKSGGSKQSTLGKFFGSNSNPAPKKQSTLAFSSKSSSSKNDETKEKDDEVAEGAPQTP
QKQVGRAESKRTPPPIDDGDVDGEILSGGEKSESVSPVTRRQKRKEAVAIKGDEESDEQP
VTKRRRRSPKSNTKAKSPVNGGRSKAAATGEQSPTKIKSDAEPEQSSAEENSASEIEEDD
IDDKPAKVQQKKKAAAKQRKQVQSTLTSKPKDLYPDWKAGDPVPYAALCTTFSHIEMTTK
RLIILSHCALFLRQVLRLTPDDLLSTVQLMINKLAADYAGIELGIGESLIMKAIGESTGR
SLAVIKADQNEIGDLGLVAAKSRSNQPTMFKPKALTVRGVHEGLLAIAKTHGTGSQEKKI
AGIKKLLSAADADKAGKGSKTIDITKNRGGASEAKFIVRFLEGKLRLGLAERTVLVALAH
AMVAHEAEMDGGKPPSTDQLAKGEDILKTVYRYAPLLNIFGGISELILCDSELPSYEVII
PAMLKHGIFNLPDNCKLQPGVPLKPMLAKPTKSISEVLDRFEGKHFTCEYKYDGERAQIH
YISRDTIKEYPAASTTLQKDGEGLCAIFSRNSEDLSKKYPDILEKLEAWVKPGTQSFVVD
CETVAWDTVNKKVLPFQQLMTRKRKDVKSEDIKVKVCVFAFDLLFLNGEPTVKKTLRERR
ALLHEAFVPVEGEFAFAQHGNTSDLEEIQTMLDESVKASCEGLMVKMLDTEDSGYEPSKR
SRNWLKVKKDYLAGIGDSLDLVVLGAYFGRGKRTSVYGAFLLAAYNPKTQNYETICNIGT
GFSEALLEELHETLSPLVIDKPKPFYSHSTVPKDQPDVWFEPKFVWEVKAADLTLSPRYS
AASDEVMGNTGGSAAKGISLRFPRYIKARDDKKPDQATTTKAVAEMYRKQESVAMDKTKG
AVDDDFEY
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaatcgggtggctcgaaacagtcaaccctagggaaatttttcggctccaat
agcaacccagcgccaaagaaacaatctacccttgcgttttcatcaaagtcaagcagtagt
aagaatgatgagaccaaggagaaagacgatgaggtcgcggaaggggcccctcaaacaccc
cagaagcaagttggccgtgcggagagcaagcgtactccaccaccaattgatgacggggat
gtagatggggaaatattgtctggtggtgagaaaagcgagtctgtttctcctgtgaccagg
aggcaaaaacgaaaggaggctgtcgcaatcaaaggtgatgaggagtcagatgagcaaccc
gtcacgaagcgccggaggagatcaccaaaatccaataccaaagccaagagccctgtcaac
ggtggtcgtagtaaggcggctgctaccggtgaacaatcgccaactaagatcaaatcggat
gctgaaccagagcaatcctccgccgaggagaattcagcttcggagattgaggaagatgat
atagacgataagccggccaaggttcagcagaagaagaaggccgcagctaaacaacggaaa
caagtccagagcactctcacatccaaacccaaagacctgtacccggattggaaggccgga
gaccccgttccctacgccgcgctttgcaccaccttctcacacatcgaaatgaccacaaaa
cgtcttattatattgtcacactgcgcgcttttcttgcgccaagtactccgtcttaccccg
gatgacttactttctaccgtccagttgatgataaataagttagcagcagattatgctgga
attgaactcggaattggtgaatctctaatcatgaaagctattggtgaatcgaccggacgc
agccttgcagtcatcaaagcagatcaaaatgaaatcggcgatcttggtcttgttgccgca
aagagtcgatcaaatcagcctaccatgttcaagcctaaagcgctgactgtacggggtgta
cacgaagggttgttggccattgctaagacgcatggtaccgggtctcaggagaaaaagatt
gcaggcattaaaaaactgctctctgctgccgatgctgacaaggcagggaaggggtcaaaa
accattgatattaccaaaaataggggtggtgctagtgaagccaaattcattgtacgattt
ttggaaggtaaacttcggcttggactggctgagaggactgtgcttgtcgctttagcccat
gcaatggtagcacacgaggctgagatggacggagggaaacctccaagtacagatcagctt
gccaagggcgaagacattcttaaaactgtctataggtatgctccacttctgaacattttt
ggtggtatatctgaattaatattgtgtgatagtgaacttccatcatatgaagtgatcatt
ccggccatgcttaaacacggaatcttcaatttgccagacaactgcaaattgcagcctggt
gttccattgaaacctatgcttgctaaacctaccaaatccattagtgaagttcttgaccga
ttcgaagggaagcatttcacatgcgaatacaagtatgatggcgagagagcacagatccat
tacatctctcgggacacaatcaaggaatacccagcggcttctacaacacttcaaaaagac
ggcgagggcctttgcgctatcttttctcgcaactctgaagacttatccaagaaataccct
gatatactcgaaaaactggaggcctgggtgaagcctggcacccagagttttgttgtggac
tgtgaaacagttgcttgggacactgttaacaaaaaggtccttccctttcaacaactcatg
actaggaagcgaaaggacgtgaaatcggaagacatcaaggttaaagtctgtgtttttgca
tttgacttgctcttcctgaatggagagcctaccgttaaaaagacgctgagggaacgacgt
gcccttttacatgaagcgtttgtgccagttgagggagagtttgcctttgctcagcacgga
aacactagcgatttggaagaaatacagaccatgcttgatgagagcgtcaaagcctcctgt
gaaggcctcatggtgaagatgttagatacagaggacagtggctatgagccaagcaagaga
agtagaaactggctgaaggtcaagaaagactaccttgctggcattggtgattccctcgat
cttgtcgtcttgggcgcatatttcggtcgtggcaaacgtacatccgtgtatggtgctttc
ctactagctgcatataatcccaagactcagaactacgaaacaatctgcaatattggcaca
ggtttctcagaagctttgttggaggaactccatgaaaccctcagcccgcttgttatcgat
aaaccaaagccgttttactctcactcaacagtccccaaggaccagccagacgtctggttt
gagcccaagttcgtatgggaagtcaaggctgctgatctcactctcagccccaggtatagc
gctgccagtgatgaagtgatgggcaacactggtggctccgcagctaagggtatctcatta
cgattcccccgatacatcaaggcgagagacgacaagaagccagaccaagctacgactaca
aaagctgttgcggagatgtatcgaaaacaggagagcgtagcaatggacaagaccaagggg
gccgtggatgatgattttgaatattga

DBGET integrated database retrieval system