KEGG   Trichophyton verrucosum: TRV_06022Help
Entry
TRV_06022         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tve  Trichophyton verrucosum
Pathway
tve00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TRV_06022
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tve02000]
    TRV_06022
Enzymes [BR:tve01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TRV_06022
Transporters [BR:tve02000]
 Other Transporters
  Pores ion channels [TC:1]
   TRV_06022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_N_4
Motif
Other DBs
NCBI-GeneID: 9584672
NCBI-ProteinID: XP_003019921
UniProt: D4DFS1
LinkDB All DBs
AA seq 286 aa AA seqDB search
MGPPPDADIHPTATGRAKEVVDKHSKEQPLKLYSGWFCPNSNTRVIAQRVWIVLEEKNIP
YQYIEVNPYKKPDSLLALNPRGLVPTIACPTIQPDGSTAIKPLYESTVINEYLEDAFPNP
EQPLHPADPYQKARGRIWIDYVTSRITPSFYRFLQYQGEEEGLNKAREEFLGHLKESILA
MDEIGPFFHGSNFMMPDIMLAPLAIRFWVTDHFKKGGLGIPAPGKGGNDEVVWNRWRMWL
AAVETRESVASTMSDKEHSMPIYKRYADDVAQSELAKATRAGKGVP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgggacctccccctgatgccgatatccacccaactgcaaccggtcgagcgaaggaggtt
gttgacaagcactccaaagagcagccactcaagctatactcaggctggttttgccccaac
tctaacacacgagttatagcccagcgagtatggatcgtcctcgaagagaaaaatatccca
tatcaatatattgaagtgaatccttataaaaaaccggactctcttcttgcccttaatcca
cggggcttagtaccaacgattgcctgtccaaccatccagccagatggatcaactgccatt
aaaccattatatgaatccaccgtgatcaatgaataccttgaagatgcattccccaacccg
gaacagccattgcacccggcagatccataccaaaaggcaagggggcgtatctggatcgac
tatgtgacctcacgaatcaccccttctttctaccgttttcttcaataccagggtgaagag
gaggggttgaacaaagcccgagaagagttcctaggtcatttaaaggaatccatcctggca
atggatgagattggtcctttctttcacgggagcaattttatgatgccggatataatgctc
gcacctttggcgattagattctgggttactgaccactttaagaaaggtgggctaggcata
ccggctccaggcaaaggagggaatgatgaagttgtttggaataggtggagaatgtggttg
gctgcagttgagacaagggaaagtgtggcttcgactatgagtgataaagaacactctatg
cctatttataaacgctatgcagatgatgttgctcagagtgaattggcaaaagcaacaaga
gctggaaagggtgtaccttga

DBGET integrated database retrieval system