KEGG   Trichophyton verrucosum: TRV_07643Help
Entry
TRV_07643         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tve  Trichophyton verrucosum
Pathway
tve00020  Citrate cycle (TCA cycle)
tve00190  Oxidative phosphorylation
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01130  Biosynthesis of antibiotics
tve01200  Carbon metabolism
Module
tve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tve_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRV_07643
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TRV_07643
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TRV_07643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 SF3a60_bindingd
Motif
Other DBs
NCBI-GeneID: 9584281
NCBI-ProteinID: XP_003018353
UniProt: D4DKC1
LinkDB All DBs
AA seq 289 aa AA seqDB search
MASLRSTSRLLRGSSALMRPVMASRSYATVEASAKPTEASSAPTSAPAPKMKTFKIYRWN
PDEPTAKPRMQTYTIDLNKTGPMVLDALIRIKNEDDPTLTFRRSCREGICGSCAMNIDGV
NTLACLCRTPTDTTKETRIYPLPHTYVVKDLVPDMTQFYKQYKSIKPYLQRDTPSPDLSF
KKGRENRQSPADRKKLDGLYECILCACCSTSCPSYWWNSEEYLGPALLLQSYRWLIDSRD
ERTEQRKAALDNSMSVYRCHTILNCSRTCPKGLNPGKAIAEIKKMMSFN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctccgctcaacttctcgtctcctccggggctcaagcgctctcatgcgaccc
gtcatggcctctcgatcgtatgccaccgttgaggcgagcgcaaagcccacagaggcctcc
tccgcgcccaccagtgcaccggcaccaaagatgaagaccttcaagatttatcgatggaac
cctgacgagccaaccgcaaaacctcgcatgcagacgtacactatcgatttgaacaagact
ggtcccatggttttggatgctttgatcaggatcaagaatgaagacgatccgaccttgacg
tttaggagaagctgcagagagggtatttgtggaagttgtgcgatgaacattgacggagta
aacactctcgcatgtctctgccgcactcctaccgacactaccaaggagactcgcatctat
cctctgcctcacacctatgttgtcaaggaccttgttccagacatgacacaattttacaag
cagtacaagtctatcaagccttatctgcaacgtgatactccatctcccgatctatctttt
aaaaagggtcgtgaaaaccgccagtcgccagctgaccgaaagaagcttgatggactgtat
gaatgtattctctgtgcttgctgctcgacctcttgcccctcctactggtggaacagtgaa
gaataccttggacctgctctcctcctccaatcctacagatggctgattgactctcgagac
gagcgaactgaacagcgcaaggctgctctcgacaacagcatgagcgtgtacagatgccac
accattcttaactgctcgagaacctgtcccaagggtctgaaccccggaaaagccattgct
gaaatcaagaaaatgatgtccttcaactaa

DBGET integrated database retrieval system