KEGG   Trichophyton verrucosum: TRV_07830Help
Entry
TRV_07830         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
tve  Trichophyton verrucosum
Pathway
tve00220  Arginine biosynthesis
tve00250  Alanine, aspartate and glutamate metabolism
tve00270  Cysteine and methionine metabolism
tve00330  Arginine and proline metabolism
tve00350  Tyrosine metabolism
tve00360  Phenylalanine metabolism
tve00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01130  Biosynthesis of antibiotics
tve01200  Carbon metabolism
tve01210  2-Oxocarboxylic acid metabolism
tve01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TRV_07830
   00270 Cysteine and methionine metabolism
    TRV_07830
   00220 Arginine biosynthesis
    TRV_07830
   00330 Arginine and proline metabolism
    TRV_07830
   00350 Tyrosine metabolism
    TRV_07830
   00360 Phenylalanine metabolism
    TRV_07830
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TRV_07830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tve01007]
    TRV_07830
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tve04131]
    TRV_07830
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tve04147]
    TRV_07830
Enzymes [BR:tve01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     TRV_07830
Amino acid related enzymes [BR:tve01007]
 Aminotransferase (transaminase)
  Class I
   TRV_07830
Membrane trafficking [BR:tve04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TRV_07830
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRV_07830
  Exosomal proteins of other body fluids (saliva and urine)
   TRV_07830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 9579343
NCBI-ProteinID: XP_003018134
UniProt: D4DKV6
LinkDB All DBs
AA seq 437 aa AA seqDB search
MAPAAVSTIARDRLDTVSRHIMTPSFFTPAAVPKAPEDPLFGLAAACRADTSDKKIDLGI
GAYRDSDAKPWVLPVVKKADRMLREDPKLNHEYLPIAGLKDFTTAAQKLILGENSPAIRE
NRVVTFQTISGTGAVHLGGLFISKFFPSTPKPTIYLSNPTWPNHPQIFKTVQLESAYYPY
FNPANKGLNLEGMLKAIRAAPSGSVILLHPCAHNPTGVDPTQHQWKQIATVIRERNHFPF
FDCAYQGFASGDLARDSWAVRYFISEGFEMCVSQSFAKNFGLYGERAGAFHFITAPGPNA
AEALSNVASQLAILQRSEISNPPAYGARIASLILNDATLFKEWEEDLRTMSGRIVEMRKG
VRERLEEKGTPGTWDHITNQIGMFSFTGLTEEQVQILREKWHIYMTKNGRISMAGLNVHN
IDYFAEAVDAVVRETTK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgctgctgtttcgaccatcgcccgcgaccgtctggatactgtctcacgccac
atcatgacgcccagcttcttcacccccgcggctgtgcccaaggctccagaagaccctctg
tttggtctcgccgctgcctgcagagctgacacctccgacaagaagatagatctcggtatc
ggtgcctacagagactccgatgcaaagccatgggtcctccccgttgtcaagaaggccgac
cgaatgctgcgggaagaccccaagctcaaccacgaataccttcctatcgccggactcaag
gacttcaccactgctgctcagaagctcatcctcggcgagaactcccctgccatcagagag
aacagagtcgtcacctttcagacaatctcaggcaccggtgccgtccatcttggaggcctg
ttcatctccaagttcttcccatccactcccaagcccaccatctacctctccaacccaaca
tggcccaaccaccctcagatcttcaagaccgtccagctcgagtcggcctactacccttac
ttcaacccggccaacaagggccttaacctcgagggcatgctcaaggccatccgcgcggct
ccctctggctccgtcatcctccttcacccatgcgcccacaatcccaccggtgtagatccc
acccagcaccagtggaagcagattgccactgtcatccgcgaacgcaaccacttccccttc
ttcgactgcgcttaccagggtttcgcctccggtgacctcgcccgtgactcctgggctgtc
cgttacttcatctccgagggcttcgagatgtgcgtctcccagtccttcgccaaaaacttc
ggtctctacggcgagcgtgctggtgccttccacttcatcactgctcccggaccgaacgcc
gccgaggccctctccaatgttgcctcccagcttgctatcctgcagcgctccgagatctct
aacccccctgcctacggtgcccgcattgcctctctcatcctcaatgacgccaccctgttc
aaggagtgggaggaggatctccgcaccatgtccggccgtatcgtcgagatgagaaagggt
gtccgagagcgtctcgaggagaagggcaccccaggtacctgggaccacatcaccaaccag
attggcatgttcagcttcaccggtctcaccgaggagcaagtccaaatcctccgtgagaag
tggcacatctacatgaccaagaacggccgtatctccatggctggccttaacgtccacaac
atcgactacttcgctgaggcagtcgatgccgtcgtcagagaaactaccaaatag

DBGET integrated database retrieval system