KEGG   Thiocystis violascens: Thivi_0691Help
Entry
Thivi_0691        CDS       T02138                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
tvi  Thiocystis violascens
Pathway
tvi00550  Peptidoglycan biosynthesis
tvi01100  Metabolic pathways
tvi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Thivi_0691
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Thivi_0691
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tvi01003]
    Thivi_0691
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tvi01011]
    Thivi_0691
Enzymes [BR:tvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Thivi_0691
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Thivi_0691
Glycosyltransferases [BR:tvi01003]
 Polysaccharide
  Bacterial polysaccharide
   Thivi_0691
Peptidoglycan biosynthesis and degradation proteins [BR:tvi01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Thivi_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB OmpA_membrane
Motif
Other DBs
NCBI-ProteinID: AFL72745
UniProt: I3Y6X7
LinkDB All DBs
Position
741586..744153
Genome map
AA seq 855 aa AA seqDB search
MEPQPNRATSTSSPHTPPDISAEPDVSRQASTASRRKTRLPRPAKRAPRSFLGWLGHFLG
LLGMPLQLLALGLLGLAVFISVTLPDLPDVESLRTVQFQEPLRVFSADGALISEFGIERR
RPVAIGEIPPLVVNAFLATEDSRFFEHGGVDTVGMGRALISYLTTGEKAQGGSTISMQVT
RNFFLSPEKTFQRKLMEVLLTLHVEQALTKDEILELYLNQIFFGHRAYGISAAASLYYDK
RLDELTEAEAAMLAGIPKAPSTNNPVTNPARALERRDYILGRMRELGYIDTNRYEIALNA
PDTALLQRRQPELDAGFIAEMVRSEMLRFYGEDAISQGYRVTTTVESWLQTAAQDSLRLS
LSQYDRRHGYRGPEAVVNLAGMSEERMDEYLATVVRIPELEPGLVTGVTSAGAEIYLGQG
QRVTLDAGRLSWARTQRNLARWNGPRRKSSGAVLAGDLIRLRRAKKGGWELSQIPRVGGA
LVSIAPRDGAVRALVGGYSFNETKFNRAVDMRRQPGSSFKPFIYAAALDKGWTPASLLKD
QAVKIPGNERWNPKNADHKELGPIRMRKALALSRNLASINLLQSVGIEEAQTYLRRFGFD
LEALPLGLSMALGTGELSPVKLAEGYAVFANGGYHVIPYFIARVEDGNGRIVFEANPPQA
CADCWYRTGTATASTQGLQPSNPAEQAIDPRIAYQMTSLLREVVEHGTGTRAKKLNREDI
VGKTGTTNDVRDSWFAGYQANFVTIAWMGFDDFGKLGRGEEGGKAALGMWIDFMRKALKD
QPLATLEPPPGLVQVRVDPNRGTETKSKSGILEMVREENRLMLLGPEPIKVAGPATRKPT
TTVKRSAPRVMDDLF
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
ttggaaccacaacccaaccgggcgacgtcgacgtcttccccgcacaccccgccagacatc
tctgcagaaccggacgtgtctcggcaggcgagtacggcatcccggcgcaaaacccgcttg
ccgcgtccagccaagcgtgcgccgcgctcctttttgggctggctgggccatttcctgggt
ctcctgggcatgcccctgcaactgctggctctgggcctgctgggcctggcggttttcatc
agcgtgacccttcccgatctgccggatgtcgagagtctgcgcacggttcagtttcaggaa
ccgctgcgagtcttcagcgccgatggcgcgcttatctcggagtttggcatcgagcgtcgc
cgtccggtggccatcggcgagattccgccgctggtggtcaatgcctttctcgccaccgag
gatagtcgctttttcgagcatggcggcgtcgataccgtcggcatgggacgggccttgatc
agttatctcacgaccggcgaaaaggcccagggcggcagtaccatctccatgcaggtcaca
cgcaattttttcctgtcaccggaaaagacctttcagcgcaagctcatggaggtgctgctg
acgttgcatgtcgagcaggccctgaccaaggacgagatcctggaactctatctgaaccag
attttcttcggacatcgcgcttacggcatctccgccgccgcatccttgtattacgacaag
cgcctcgacgagctcaccgaggccgaggcggcgatgctggcgggcattcccaaggccccg
tccacgaacaatccggtgacgaatccggcccgcgcgctggagcggcgcgattacatcttg
gggcggatgcgcgaactcggctacatcgacacgaatcgctatgagatcgccctcaatgcg
cccgataccgcgctcctgcaacgccgtcagccagagctggacgctggtttcatcgccgaa
atggtgcgctcggaaatgctgcggttttacggcgaggacgcgatcagccaggggtatcgg
gtgacgaccacggtcgaatcctggctgcagaccgcggcccaggattccctgcggctgtcg
ctgagtcaatatgaccgccgacacggctatcgcggtcccgaggcggtcgtgaatctggcc
gggatgtcagaggaacggatggacgagtatctggcgacagtggtccggatcccggagctg
gagccagggctggtgaccggggttacctcggccggggcggagatttatcttggccagggt
cagcgcgtcacgctggacgcaggccgtctctcctgggcgcggacccagcgcaatctggcc
cgctggaacggtccgcggcgtaaatcctccggagcggtgctcgcgggcgacctgattcgt
ctccgacgggcaaaaaaaggcggctgggagctgagtcagatcccgcgcgtcggcggcgcc
ctggtgtccattgccccgcgcgacggagccgtgcgcgcgctggtcggcggttactctttt
aacgagacgaaattcaaccgtgccgtggacatgcgccgtcaacccggatccagtttcaag
ccgttcatctatgccgccgcgctcgacaaaggctggaccccggccagtctgctcaaggac
caggcggtcaagatacccggcaacgagcgctggaaccccaaaaacgccgaccacaaggaa
ctcgggccgatccgcatgcgcaaggccctggcgctttcgcgtaacctggccagcatcaat
ctgttgcagagcgtcggcatcgaggaggcccagacttatctccgccgctttggcttcgat
ctcgaagccctgccgctgggcctctcgatggcgctcggtaccggcgaactctcgccggtc
aaactcgccgagggttatgccgtctttgcgaacggcggttatcacgtcatcccctatttc
attgcgcgcgtggaggatggcaacggtcggatcgtcttcgaggccaatccgccgcaagcc
tgcgccgattgctggtaccgcaccggaacggcgacggccagcacccagggactccaaccg
agcaatcccgcggagcaggcgatcgatccgcggattgcctatcagatgacctcgctgctg
cgtgaagtggtggagcatggcacggggacgcgcgccaagaagctgaatcgcgaggatatt
gtcggcaagaccggcacgaccaacgatgtccgcgattcctggttcgcgggctatcaggcc
aacttcgtaacgattgcctggatgggcttcgacgacttcggcaagcttggccggggggag
gagggcggcaaggccgcgctgggaatgtggatcgatttcatgcgcaaggcactcaaggat
cagccgctcgccacgcttgagccgccgcccggtctggtgcaggttcgcgtcgatccgaat
cgggggaccgaaaccaaatccaagagcggaatcctggagatggtgcgggaggaaaaccgc
ctaatgctactcggtcccgagccgatcaaggtcgctggtccagccacgcgaaaaccgacc
acgaccgtcaaacgctcggcgccgcgagtcatggacgacctgttttag

DBGET integrated database retrieval system