KEGG   Thiocystis violascens: Thivi_1920Help
Entry
Thivi_1920        CDS       T02138                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4)
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
tvi  Thiocystis violascens
Pathway
tvi00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Thivi_1920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tvi01002]
    Thivi_1920
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tvi01011]
    Thivi_1920
Enzymes [BR:tvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Thivi_1920
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Thivi_1920
Peptidases and inhibitors [BR:tvi01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Thivi_1920
Peptidoglycan biosynthesis and degradation proteins [BR:tvi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Thivi_1920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AFL73880
UniProt: I3YA62
LinkDB All DBs
Position
2099227..2100444
Genome map
AA seq 405 aa AA seqDB search
MKPLTHPLVSRPCHWINALPILLALALSIPPAMAADPVAQVKGMDQASLLLEERGRDLVA
HHPDTPRVPASTMKLLTAFAALETWGREYRFLTDVHRDDANGLWVKGYADPYLVSEELDR
MVAALKSKGLREVAGIGIDDSFFGPDVEIAGRSSSDNPYDAPVTALAANFNTLNLVRTGD
QVHSAEPQTPLTATARRFGLAGAAGKQRVNLREREVALRYFGELLAAKLEQTGVRVGDQR
KIAPMPRHAKRFYRHANSRTLVEIVEPMLKFSNNFIANSLFLRLADPEGNTGVSMASARL
KMTDFARRRFGWREFRIEDGAGLSRGNRLSARQLVELLDAFAPYRDLLSEQDGNPNVRAK
TGTLRGVSCYAGYVRRESAWLPFALLINQPVEYTLRQRVASNLAR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccactgacccaccccctcgtttcccgtccgtgtcactggattaacgccctaccg
attctgcttgcgctggcgctatcgatcccgccagccatggcggcggacccggtcgctcag
gtcaagggcatggaccaggccagtctgctgcttgaggagcgtgggcgcgatctggtcgct
catcatcccgacacaccacgcgtcccggcctcgaccatgaagctgctgacggcctttgcg
gcactggaaacctggggacgggagtatcgcttcctgaccgacgttcaccgcgatgacgcc
aatgggctctgggtgaagggctatgccgacccctatctcgtgtcggaggaactggatcgg
atggtcgccgcgctcaaatccaaagggctgcgcgaggtcgccggtatcggcatcgatgac
agctttttcggcccggacgtggagattgccggacggtcctcctcggataacccttatgac
gcgccggtcaccgcgttggcggccaatttcaatacgctcaatctggttcgcactggcgat
caggtgcacagtgccgagccccaaactccgctgaccgcaaccgcccgtcgcttcggactg
gccggcgccgctggcaagcagcgggtgaatctgcgcgaacgcgaggttgcgctgcgctat
ttcggcgaattgctggccgccaagctggaacagacgggggtgcgcgtcggagatcagcga
aaaatcgcccccatgccacgtcacgccaagcgcttctatcgccacgccaacagccgcacc
ctggtggagatcgtcgaacccatgctcaaattctccaataacttcattgccaactcactc
tttctgcgactggcggacccggagggaaacaccggcgtgagcatggcctccgccagactg
aaaatgacggacttcgcgcgtcgccgcttcggttggcgcgaattcaggattgaggatggc
gccggcctgtcgcgtggcaaccgactcagcgcacggcaactcgtcgagttgctggatgcc
tttgctccttatcgtgatctactgtcggaacaggatggcaacccgaacgtgcgcgccaag
actggaacgctgcgtggcgtgagctgctacgctgggtatgtgcgacgcgagagcgcttgg
ttgcccttcgcgctgctgatcaatcagccagtggaatacacgcttaggcagcgcgtcgcg
agcaacctggcacgctga

DBGET integrated database retrieval system