KEGG   Thiocystis violascens: Thivi_1992Help
Entry
Thivi_1992        CDS       T02138                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tvi  Thiocystis violascens
Pathway
tvi00630  Glyoxylate and dicarboxylate metabolism
tvi00710  Carbon fixation in photosynthetic organisms
tvi01100  Metabolic pathways
tvi01120  Microbial metabolism in diverse environments
tvi01200  Carbon metabolism
Module
tvi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Thivi_1992
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thivi_1992
Enzymes [BR:tvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Thivi_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N HEAT
Motif
Other DBs
NCBI-ProteinID: AFL73950
UniProt: I3YAD2
LinkDB All DBs
Position
complement(2171326..2172678)
Genome map
AA seq 450 aa AA seqDB search
MKDSDWSGFFADAAALNPDAYIILDYYLECIGDPRIAAAHFCSEQSTAQWRRVGSSEDLR
PRFAARVVDLTVLESGRPGFSYGIAHSQGGDVQACRVTIAHPHGNFGPRLPNLLSAVCGE
GTFFSPGAPVVKLLDIHLPDAYLAEFEGPRFGVEGLRDLLQVYDRPLFFGVIKPNIGLPP
EAFSDLGYQSWLGGLDIAKDDEMLGDTEWCPLARRSELLGAARQRAEQATGCPKFYLANI
TDEVERLIDLHDIAVANGANALLINAMPVGLSAVRMLRRHARVPLIAHFPFIAPFSRLPN
FGVHSRVFAKLQRLAGFDAIIMPGFGERMHSSDDEVRENVAACLAPMGAIKPSLPVPGGS
DWAGTLKGVYDKVGTIDFGFVPGRGVFGHPMGPRGGAASIRQAWDAIVAGVSLGEQAAKH
VELRAAIETFGRNDIAPPDEAAGKCTGDES
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattccgattggtcggggttcttcgccgatgcggccgcgttgaacccggatgcc
tatatcattctcgattactatctcgaatgtatcggcgatccacggatcgcggcggcgcat
ttctgttccgagcagtcgacggctcaatggcggcgcgtcggttcatccgaagacctcagg
ccgcgttttgccgcgcgggtcgtcgacctgaccgttctggaatcgggtcggcccggattc
agctacggaatcgctcattctcagggtggtgacgtgcaggcttgccgggtgacgatcgct
catccgcatgggaatttcggtccccgcttgcccaatctcttgagcgccgtctgcggagaa
ggcacgttcttttcgcccggagcaccggtcgtcaaactgctggacattcatttaccggat
gcctatctggccgagttcgaggggccgcgttttggggtcgaaggactccgtgacctgctt
caggtctatgatcggccactcttctttggcgtgatcaagccgaatatcgggttgccacca
gaagctttcagcgacctgggttatcaaagctggctgggcggactggatattgctaaggac
gacgagatgctgggcgacaccgaatggtgtccgctggcgcggcgctcggaactcttgggc
gcggcacggcaacgggcagagcaggcaacgggatgtccaaagttctatctcgcaaacatc
acggatgaagtggagcgtctgatcgacttacatgatatcgccgtcgcgaatggcgcgaac
gccctgctgatcaacgcgatgcccgtcggtttgagcgcggtccgcatgctgcgtcgacac
gcgcgtgtgccgctgattgcgcatttcccctttatcgccccgttcagccgtcttcccaac
tttggcgttcattccagggtttttgccaaactccagcggctcgcggggttcgacgcgatt
atcatgccggggtttggggagcgaatgcattcgtcggatgacgaagtgagagagaatgtt
gccgcctgtcttgcacccatgggcgcgatcaagcctagcttgcctgtccctggcgggagc
gattgggccgggacattgaagggcgtctacgataaggttggtacgatcgatttcggattc
gttccgggccgcggcgtctttggtcatccgatggggccccgagggggggcggcgagcatc
cgtcaggcatgggatgcgatcgttgccggcgtttcccttggcgaacaggccgcgaagcat
gtggagttgcgtgcggcgatcgagacattcgggcggaatgacatcgcaccgcccgacgaa
gccgctgggaaatgcacgggagacgaatcgtga

DBGET integrated database retrieval system