KEGG   Thiocystis violascens: Thivi_2806Help
Entry
Thivi_2806        CDS       T02138                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tvi  Thiocystis violascens
Pathway
tvi00620  Pyruvate metabolism
tvi00680  Methane metabolism
tvi00710  Carbon fixation in photosynthetic organisms
tvi01100  Metabolic pathways
tvi01120  Microbial metabolism in diverse environments
tvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thivi_2806
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thivi_2806
   00680 Methane metabolism
    Thivi_2806
Enzymes [BR:tvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Thivi_2806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFL74724
UniProt: I3YCK6
LinkDB All DBs
Position
3081155..3083959
Genome map
AA seq 934 aa AA seqDB search
MLIPMNEITQDQALERDVQLFTALLGEVLREHSRKRVLVIVERLREGFMQLREQEDAELR
EKLMKRIEGLDPQTLSEVIRAFTIYFGLVNTAEELNAHLARMDRISAGQRLWVGSFDDTV
RQFQEDGISPEHFQSLLEHLLYLPVFTAHPTEAKRRTIMETFRRIFLVGQDLRRRKLNDE
EIEEKLQEILTQIQILWKTDEVRVHKPQVIDEVRQGLYFFRESLFEAVPLVYRFLEKAVR
RVYGANHGVKVPSFIRFGSWIGGDRDGNPFVTPETTELTVRMHAELVLEEYLERIRKLRR
MLSHSSGFCEPSPALLDSLDADEDYWVATMGQSLRRFLNEPYRRKLAMMSHRLGANLARI
RARIENRDADHVSRGYGSDRDFLADLYLIRDSLIHHGDASAAAGPLQDLIRLAETFGFHL
VHLDIRQESTRHTEAITELFARQAGAPFYQAFTEEQRLMALSETIAHPHPFVIDKATLTP
ETRETLEVFEVIARLRAEIGEKVFGQYVISMTHAASHVMEAMLLARLAGLAGKDRQGWFC
NLQISPLFETIDDLEHIDQVMGTLFDHPTYQALLKASGNQQEVMLGYSDSCKDGGILSSG
WNLFEAQKKIIALADDRGVSCRLFHGRGGTVGRGGGPTHEAILAQPVDTVHGQIKFTEQG
EVLSYRYANPETARYELTMGISGLIKASRCLIEPPVEERNDYLGIMDELSRHGEEAYRKL
IRETEGFLDYFYECTPLDGIALLNIGSRPSHRKKADRSLGSIRAIPWVFGWGQSRHTLPA
WFSIGHAIERYRNNDLERLAKLQKMYQDWPYFRALLSNTQMSLFKAEMRIAREYVNLAEN
REQAESIYRLIEDEYNRTLTQVLNVAGLLGLMEETPELRHSLARRNQYLDPLSYIQVAVL
GRYRAEPEEDKRAEWLDPLLRSINAIAAGMRNTG
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcccgatgaacgagattacccaagatcaggcgctggagcgcgatgtccagctc
ttcaccgccctgctgggcgaggtgctgcgcgagcacagccgcaagcgcgtcctggtgatc
gtcgagcgcttgcgcgaaggcttcatgcaattgcgcgaacaggaagacgccgaactgcgc
gagaaattgatgaagcgcatcgagggcctggatccccagacgctgtccgaggtcatccgc
gccttcaccatctatttcggtctggtcaataccgccgaggagctgaatgcccatctggcg
cgcatggaccgcatctcggccggccagcgactgtgggtcggttccttcgacgacacggtg
cgtcagttccaggaggacggcatcagtccggagcatttccagagcctgctggagcatctg
ctctatctgccggtgttcaccgcgcaccccaccgaggccaagcggcggaccatcatggag
accttccggcgcatcttcctggtcggtcaggatctgcgccggcgcaagctcaacgacgag
gagatcgaggaaaaactccaggagatcctgacccagatccagatcctctggaagaccgac
gaggtgcgggtccacaaaccccaggtcatcgacgaggtgcgccagggcctgtatttcttc
cgcgaatcgctgttcgaggcggtaccgctggtctatcgctttctggagaaggcggtgcgg
cgggtctacggggccaatcatggcgtcaaggtgccgagcttcatccgcttcggctcctgg
atcggcggcgaccgcgacggcaaccccttcgtgaccccggagacgaccgaactgacggtg
cgcatgcacgccgaactggtgctggaagagtatctggagcgcatccgcaagctgcgccgg
atgctcagtcattccagcggattctgcgagccctcgccggccctgctcgacagtctggac
gccgacgaggactactgggtcgcgaccatgggccagagtctgcgccgcttcctgaacgaa
ccctaccggcgcaagctggccatgatgagccatcgtctgggggcgaatctggcgcgcatc
cgcgcccgtatcgagaaccgcgacgccgatcatgtgtcccgcggctacggcagcgaccgc
gactttctcgccgacctctatctcattcgcgactcgctcatccatcatggcgacgccagc
gcggcggccggtcctctgcaggatctgatccgtctcgccgagaccttcggtttccatctg
gtgcatctggacatccggcaggaatccacccgtcacaccgaggccatcaccgaactgttc
gcccgccaggccggcgcgcccttttatcaggcgttcaccgaggagcagcgtctgatggcg
ctgtccgagaccatcgcccacccgcatcccttcgtgatcgacaaggccacgctgaccccg
gagacccgcgagacccttgaagtcttcgaggtcatcgcgcgcctgcgcgccgagatcggc
gagaaggttttcggtcagtacgtcatctccatgacccatgccgccagtcatgtcatggag
gcgatgctgctggcgcgtctggccggactggccgggaaggatcgtcagggctggttctgc
aacctccagatttcgccgctgttcgagaccatcgacgacctggagcatatcgaccaggtg
atgggtacgctgttcgatcatccgacctatcaggcgctgctcaaggcgtcggggaaccag
caggaggtgatgctcggatattcggattcctgcaaggacggcggcatcctctcctcgggc
tggaacctgttcgaggcgcagaaaaagatcatcgcgctcgccgatgatcgcggcgtgtcc
tgtcggctctttcacggtcgcggcgggaccgtggggcgcggcggcggtccgacccacgag
gcgatcctggcccagccagtcgacaccgtgcacggtcagatcaagttcaccgaacagggc
gaggtgctgtcctatcgctatgccaatccggaaaccgcccgctatgagttgaccatgggc
atcagcggtctgatcaaggccagccgctgtctgatcgagccgccggtggaggagcgcaac
gactatctcgggatcatggacgagctgtcgcgccatggcgaggaggcgtaccgcaagctg
attcgggagaccgagggttttctggattatttctacgaatgcaccccgctcgacggtatc
gccctgctcaacatcggctcgcgcccgtcgcatcgcaagaaggccgatcgctcgctcggc
tccatccgcgccatcccctgggtcttcggctggggccagtcgcgtcataccctgccggcc
tggttcagcatcggtcacgccatcgagcgctatcgcaacaatgacttagagcgtctggcc
aagctccaaaaaatgtatcaggattggccctatttccgggcgctgctgtccaacacccag
atgtcgctgttcaaggccgagatgcggatcgcccgcgaatacgtgaacctggccgagaac
cgcgaacaggccgagtccatctatcgcttgatcgaggacgaatacaaccgaacactgacg
caggtgctcaatgttgccgggctgctcggtctgatggaagaaacccctgagctgcgtcat
tcgctggcccgtcgcaaccagtatctggatcccttgagttatatccaggtggcggtgctc
gggcgctatcgcgccgagccggaggaagacaaacgcgcggaatggctggatccgctgcta
cggtccatcaatgccatcgcggcggggatgcggaataccggataa

DBGET integrated database retrieval system