KEGG   Thiocystis violascens: Thivi_3115Help
Entry
Thivi_3115        CDS       T02138                                 

Definition
(GenBank) ATP dependent DNA ligase-like protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tvi  Thiocystis violascens
Pathway
tvi03030  DNA replication
tvi03410  Base excision repair
tvi03420  Nucleotide excision repair
tvi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Thivi_3115
   03410 Base excision repair
    Thivi_3115
   03420 Nucleotide excision repair
    Thivi_3115
   03430 Mismatch repair
    Thivi_3115
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tvi03032]
    Thivi_3115
   03400 DNA repair and recombination proteins [BR:tvi03400]
    Thivi_3115
Enzymes [BR:tvi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Thivi_3115
    6.5.1.6  DNA ligase (ATP or NAD+)
     Thivi_3115
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Thivi_3115
DNA replication proteins [BR:tvi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Thivi_3115
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Thivi_3115
DNA repair and recombination proteins [BR:tvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Thivi_3115
   NER (nucleotide excision repair)
    Other NER factors
     Thivi_3115
   MMR (mismatch exicision repair)
    Other MMR factors
     Thivi_3115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AFL74992
UniProt: I3YDC4
LinkDB All DBs
Position
3405631..3406560
Genome map
AA seq 309 aa AA seqDB search
MLLLLLKPPNGYATMPRFPFRLTSRWLLFLCLAAPPGFARDVVALPSQPVPTTKPALMLA
NVYTEGVDLSAYWVSEKLDGVRAYWDGARLISRGGHPIQSPEWFTAGFPAIPLDGELWMG
RGTFERLSGTVRRLEPAPDDWREIRFMVFDLPDLDAPFGQRLQRLQQVLADSANPSLVPV
EQVRIANHADLMARLDAVVQAGGEGLMLHRDGADYRAGRTDDLLKVKPYQDAEARVIEHL
PGQGKYAGMLGALLVEDANGLRFRLGTGFTDAERRAPPPLGSLVTYKYLGYTEKGIPRFA
SFLRVRAPE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgcttctcctgaaaccgccgaacggatacgcgaccatgccgaggttccccttc
cgcctcacctcccggtggctcctgttcctctgtctggccgcgccgcctggattcgctcgg
gatgtcgtcgcactgcccagccagcctgtcccgacgaccaaaccggccctgatgctggcg
aacgtctacaccgaaggcgtcgatctatcggcgtattgggtcagcgagaagctcgacggc
gtgcgcgcttactgggatggcgcgcgcctgatcagccgtggcgggcatccgatccagtcg
cccgagtggttcacggcgggatttcccgcgatccccctggatggcgaactctggatggga
cgcggaaccttcgagcgtctgtcgggcacggtgcggcgactggagcccgcgccggatgac
tggcgggagatccgcttcatggtcttcgatctgccggatctcgatgcgccattcggtcag
cggctccagcggttgcaacaggtgctcgccgactcggccaatccctctctggtccccgtc
gagcaagttcggatcgcgaaccacgcggacctgatggcgcggctggatgcggtcgtccag
gccggcggcgaggggctcatgctgcaccgcgatggcgcggactatcgggcggggcgcacg
gatgacctgctcaaggtcaagccttatcaggatgccgaggcccgggtgatcgaacatctg
cccggccagggtaaatacgcggggatgctgggcgcgcttctggtggaggatgccaatggt
ctgcgctttcgtctcgggaccggtttcacggatgccgagcggcgcgcaccgccaccgctt
ggcagtctggtgacctacaaatatctgggctatacggagaaaggaatcccgcgcttcgcg
agttttctgcgggtgcgcgcgcccgagtaa

DBGET integrated database retrieval system