KEGG   Thiocystis violascens: Thivi_3289Help
Entry
Thivi_3289        CDS       T02138                                 

Definition
(GenBank) histidine kinase
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
tvi  Thiocystis violascens
Pathway
tvi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Thivi_3289
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tvi01001]
    Thivi_3289
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tvi02022]
    Thivi_3289
   02035 Bacterial motility proteins [BR:tvi02035]
    Thivi_3289
Enzymes [BR:tvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Thivi_3289
Protein kinases [BR:tvi01001]
 Histidine kinases
  NtrC family
   Thivi_3289
Two-component system [BR:tvi02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   Thivi_3289
Bacterial motility proteins [BR:tvi02035]
 Pilus system
  Twitching motility proteins
   Thivi_3289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_2 PAS_8 PAS PAS_7 B-block_TFIIIC
Motif
Other DBs
NCBI-ProteinID: AFL75163
UniProt: I3YDU5
LinkDB All DBs
Position
complement(3594902..3596536)
Genome map
AA seq 544 aa AA seqDB search
MGRTQEDPNPPAAPGATGAPAPDPGARYPTWGALRWLLVFRMLILCGLILVFSPAVVDPA
TGRVDTRFAWSILLVYAPLVLLGGLSLANRWPHRIQQVQIGIFVDILAYTLLMHAAGGIA
SGLGILLAVAVAAAALMMEGRLSLLFAALASLAIFAQQIYSAMQGDAHATSFTQAGLLGL
LFFMVALMSHVLYRRVRSAEALAARRKVDIDDLSKLNDFIIQSIGTGILVADGERRLRLL
NRAALDLLGAKRFNTGAALSDLSPELGAWLATQVRPSPPNGRLIHIGDREIRVSLKLLGD
YRASGVILYLRDNREVAREAQQIKLASLGTLTASIAHNIRNPLSAMTHASQLLTESPGLT
DDDHHLLEIVRRNGARIEETVHSVLQLSSRNQRQPSPIDLAVWLEEFAAEFRERHQLNEN
ALQLAFDADAIAVEADPRHLHQILANLCENALIHGRQDAQPARILIRLDRTGDLGEALIE
IIDAGPGIDAATVNEIFNPFYTTTSKGTGLGLYIARELAESNGIRLTYAPAKPQGSCFRL
VFSG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgggccggacgcaggaagacccgaatcccccagcggcacctggcgcgacaggtgcgccc
gcacccgatcctggcgcgcgctatccgacctggggcgcgttacgctggctgttggtcttc
cgcatgctgattttatgcggcttgattctggtcttttccccggcggtcgtggatccggcg
acgggcagagtcgacacccgattcgcctggtccatcctgctggtttacgcaccgctggtt
ctgctcggcgggctatccctggcgaatcgttggccgcaccggatccaacaggtccagatc
ggcattttcgtcgatatcctcgcctataccctcctgatgcatgccgcggggggcattgcc
agcgggcttggcatcctgctcgccgtcgcggtcgccgccgccgcgttgatgatggaaggc
cgtctgtcgctgctgttcgccgcgctcgcctcgctggccatctttgcccagcagatctat
tccgccatgcagggcgatgcgcacgccacgtccttcacccaagccggcctgctgggtctg
ttgttttttatggtcgcgctgatgtcgcatgtgctgtatcggcgcgtgcgctcggcggag
gcgttggcggcgcggcgcaaggtcgacatcgacgatctctcgaaactcaacgacttcatc
atccaaagcatcggcaccggcatcctggtggccgatggtgaacgccgcttgcgactgctc
aaccgggccgcgctggatttactcggagccaagcggttcaacaccggggcggcgctgtcc
gatctctcgcccgaactgggcgcctggctggcgacgcaggtgcggccgtcccctcccaat
gggcggctgatccacatcggcgaccgggagattcgggtctcgctcaagctgctgggcgac
tatcgcgccagcggcgtcatcctctatctgcgcgacaaccgggaggtcgccagggaggcc
cagcagatcaagctcgcctcgctggggacattgaccgcgagcattgcccacaatattcgc
aatccgttgagtgccatgacccatgccagccaattattgaccgaaagtccggggctgacc
gacgatgaccatcacctgctggagatcgtccgccgcaacggcgcgcgcatcgaagaaacc
gtgcacagcgtgctgcaactctccagtcgcaatcagcggcagccttccccgatcgatctg
gccgtctggctggaggagttcgccgccgaatttcgcgaacgccatcaattgaacgagaac
gcgctccaactcgcgttcgacgcggacgccatcgccgtcgaggccgatccccgccatctc
catcagatccttgccaatctgtgcgaaaacgcgctcatccatggcagacaggacgcgcag
ccggcccggattctgattcggctcgaccggaccggcgacctgggcgaggcgctgatcgag
attatcgatgcgggaccggggatcgatgccgcgaccgtcaatgagatcttcaacccattt
tatacgacgacctccaaggggaccgggcttgggctttacatcgcgcgggaactcgcggag
agcaatgggattcggctgacctacgcgcctgccaaaccccagggcagttgcttcaggctg
gtcttttccggctga

DBGET integrated database retrieval system