KEGG   Thiocystis violascens: Thivi_4336
Entry
Thivi_4336        CDS       T02138                                 

Definition
(GenBank) signal transduction histidine kinase
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
tvi  Thiocystis violascens
Pathway
tvi01503  Cationic antimicrobial peptide (CAMP) resistance
tvi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Thivi_4336
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Thivi_4336
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tvi01001]
    Thivi_4336
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tvi02022]
    Thivi_4336
   01504 Antimicrobial resistance genes [BR:tvi01504]
    Thivi_4336
Enzymes [BR:tvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Thivi_4336
Protein kinases [BR:tvi01001]
 Histidine kinases
  OmpR family
   Thivi_4336
Two-component system [BR:tvi02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   Thivi_4336
Antimicrobial resistance genes [BR:tvi01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    Thivi_4336
SSDB
Motif
Pfam: HATPase_c HAMP HATPase_c_5 HATPase_c_2 HPTransfase HisKA HATPase_c_3
Other DBs
NCBI-ProteinID: AFL76146
UniProt: I3YGM8
LinkDB
Position
4711683..4713020
AA seq 445 aa
MMSLRTRVVLSAAAVLTVFILLTSLALERAVRETAESAREERLQAQIFLLMAAGEEESSG
LVFPNALAESRLTLPGSGLYALVLNALGDPIWQSPSAVGVDIPLPQPLAPGQRRFERRQG
SDGQEDYLVLGFGVSWATGPVPQDYSFVVAEDASAFESEVSQFRASLAGWLGAMALLMLV
ALVLILRWGLTPLRRVAAEVAAIESGDRTQIQGRYPAEIRALTGNLNALLAHERARQRRL
DNTLGDLAHSLKTPLAVMRGALDEEDSPTADLLREQLARMGTIVEYQLQRARASGQPLAT
LAPPIPVRRVAERLSASLAKVHRDKSVAVTLDIDPTADFRGVEGDLFEMLGNLLENAFKW
CGQRIRVSGASSRGVLTITVEDDGPGIPPDQAIRLLERGARADEATPGHGIGLAVVRELC
EAYGGDIRVERGALGGARIRLRLPH
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgatgtcgctgcgcacgcgcgtggtgctgtccgccgccgccgtgctgaccgtcttcatc
ctcctgactagcctcgccttggagcgcgcggtgcgcgagaccgccgaatccgcgcgcgag
gagcgcttgcaggcgcagatctttctgctgatggcggcgggcgaggaggaatcgtcgggg
ttggtgtttcccaatgcgctcgccgaatcccggctcaccctgccgggctccgggctgtac
gcactggtcctaaacgcgctgggcgatccgatctggcaatccccgtccgccgtgggcgtg
gacatcccgctgccccagccgctcgcccccggacagcggcgcttcgagcgccggcaggga
agcgacggacaagaagactatctagtgctcgggttcggcgtgtcctgggccaccggcccg
gtcccgcaggactacagcttcgtcgtcgccgaggatgcgtccgcgttcgagtccgaggtg
agccagtttcgcgccagtctcgccggttggctgggcgccatggcgctgctgatgctggtg
gcgctggtgctgattttacgttggggactgacgcctctacgtcgggtcgcggcggaggtg
gcagccatcgagtccggtgatcggacgcagatccagggccgctatcccgccgagatccgc
gccctgaccggcaatctgaacgccctgctcgcccatgagcgggcgcgtcaacggcgtctc
gacaatacgctcggcgaccttgcccacagtctcaagacaccgctcgcggtcatgcgcggc
gcgctcgacgaagaggactctccaaccgctgacctgttgcgggaacaactggcgcgcatg
gggacgatcgtcgagtaccagttacaacgggcgcgtgccagcggccagccgttggcgaca
ctggcccctccgatccccgtgcggcgggtcgcggaacgcctgtcggcgtccctggccaaa
gttcaccgcgacaaatcggtggcggtcacgctagacattgatccgacggccgattttcgt
ggcgtcgagggagatctattcgagatgctcggcaatctgctggaaaacgccttcaagtgg
tgcggacagcggatccgcgtctccggcgcatccagtcggggcgtcctgaccatcacggtc
gaggacgacggccccggcatcccgcccgaccaggcgatccgacttctcgaacgtggggcg
cgcgcggacgaggcaacgcctggacatggcatcggactcgccgtggtgcgcgagctgtgc
gaggcgtatggcggcgacattcgggtcgaacgcggtgcgctgggcggggcgcgaattcga
ctgcgcttaccgcattaa

DBGET integrated database retrieval system