KEGG   Thermosynechococcus vulcanus: NIES2134_107580Help
Entry
NIES2134_107580   CDS       T05980                                 

Definition
(GenBank) Glu-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
tvn  Thermosynechococcus vulcanus
Pathway
tvn00970  Aminoacyl-tRNA biosynthesis
tvn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NIES2134_107580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tvn03029]
    NIES2134_107580
Enzymes [BR:tvn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NIES2134_107580
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NIES2134_107580
Mitochondrial biogenesis [BR:tvn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NIES2134_107580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: BAY51650
LinkDB All DBs
Position
complement(767782..769284)
Genome map
AA seq 500 aa AA seqDB search
MAPEPTPVDAASLTYEAVIGLEIHCQLSTQTKIFSSSSTQFGAPPNTNIDPVCLGLPGTL
PVLNEKVLEYAVKAGLALNCQIAPYSKFDRKQYFYPDLPKNYQISQYDLPIAHHGYLEIE
LVDDKGTARRKKIGITRLHMEEDAGKLVHAGSDRLSGSAYSLVDLNRAGVPLVEIVSEPD
LRTGQEAAEYAQELRRILRYLGVCDGNMQEGSLRCDVNISVRPVGSNTFGTKVEIKNMNS
FSAIQRAIDYEIERQVAALKAGEPIVQETRLWDEATQETRTMRVKEGSSDYRYFPEPDLG
PIEVTAEQLAAWRAELPELPAQKRRRYESEWGLPPQDARVLTDERAVAEYFEATVVAGAP
PKLAANWIMGDITAYLKEQKLAIEALPLKPAELAELIQLIEAGTISGKIAKEILPELLSQ
GGSPKALVERKGLSQISDVATLEAMIDEVLAAHPNELEQYRAGKTKLQGFFVGQLMKKSG
GRADPKLANQLLAQKLNPGS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcctgaacccacccctgtagatgccgctagtctcacctacgaggcggtgattggc
ctagagattcactgccaactcagtacccaaacaaaaattttctcctctagctcgacccag
tttggagcacccccaaataccaacattgatccggtgtgtttggggttgccggggacgctc
cctgtgttgaatgaaaaggttctcgagtacgctgtcaaggcgggtttagccctcaattgt
cagattgccccctacagcaagttcgatcgcaagcagtatttttatcctgacttgccgaaa
aactatcaaatctcgcagtacgatctgcccattgcccaccatggctatcttgagattgaa
ctggtggatgacaaggggactgcccgccgtaaaaaaattggcattactcgcctgcacatg
gaggaagatgccggcaagttggtccatgcggggagcgatcgcctgtctggctccgcctac
tccctagtggacttgaatcgcgccggggtgcccttggtggagattgtctccgagccagat
ttgcgcaccggtcaagaggcggcggaatatgcccaagaactgcggcgcattctccgttac
ttgggggtttgtgatggcaatatgcaggagggctcgctgcgctgcgatgtcaatatctcc
gtgcggccagtgggcagcaacacctttggcaccaaggtggagattaaaaacatgaactcc
tttagtgccatccaacgtgccattgactatgaaattgagcgacaagtggctgccctcaaa
gcgggggaacccatcgttcaagaaacgcggctctgggatgaggccacccaagaaacgcga
accatgcgggtcaaggaaggctccagtgactaccgctactttcctgaacccgatctcgga
cctattgaggtcactgctgagcaattggcggcatggcgcgctgagctgcccgaactccct
gcccaaaaacgccgccgctatgaatcggagtggggattaccaccccaggatgcccgcgtt
ctcaccgatgagcgagccgttgctgaatactttgaggcaaccgttgtcgcaggggcaccc
ccgaaattagcggccaactggatcatgggggatattaccgcctatctcaaggaacaaaaa
ctggcgatcgaggcactgcccctgaaaccggcggaattagcggagttgatccaactcatt
gaggcgggcaccattagtggcaaaattgccaaggagatcttgcccgaattactctcccaa
gggggttcgccaaaagccctggtggagcgcaaaggcctcagccaaatttctgatgttgcc
accctagaggcaatgattgatgaggtactggcggcacatcccaatgaactggagcaatac
cgtgctggcaagaccaaacttcaaggcttctttgttggccaactgatgaaaaaaagtggc
gggcgtgccgatccgaagctagcgaatcaactcctggctcaaaagctaaaccctggcagc
tag

DBGET integrated database retrieval system