KEGG   Thermosynechococcus vulcanus: NIES2134_112570
Entry
NIES2134_112570   CDS       T05980                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tvn  Thermosynechococcus vulcanus
Pathway
tvn00010  Glycolysis / Gluconeogenesis
tvn00020  Citrate cycle (TCA cycle)
tvn00620  Pyruvate metabolism
tvn01100  Metabolic pathways
tvn01110  Biosynthesis of secondary metabolites
tvn01120  Microbial metabolism in diverse environments
tvn01200  Carbon metabolism
Module
tvn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tvn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES2134_112570
   00020 Citrate cycle (TCA cycle)
    NIES2134_112570
   00620 Pyruvate metabolism
    NIES2134_112570
Enzymes [BR:tvn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIES2134_112570
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl ATP-grasp MadL AATase
Other DBs
NCBI-ProteinID: BAY51158
LinkDB
Position
1272604..1273884
AA seq 426 aa
MIRELFMPALSSTMTEGKIVSWLKSPGDKVTKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGEVAPVGSTIGLVAETEAEIAEAEAKAKSLGTATSSAPAPASTSTVATSNGSGTAPV
VAAPAASAAVPAGRVMASPRARKLAKEHKIDLKTLKGTGPNGRITAADVEALIGAPATPV
PPVATSPAPIPTAPPATAAVVAKEDLVPLTTLQNAVVRNMVASLGIPDFHVAYTITTDAL
DRLYQQIKSKGVTMTALLAKAIALTLQKHPIMNAYYTEQGIQYRRDINIAVAVAMPGGGL
ITPVLKNADQIDIYSLSRTWKDLVERARAKQLQPDEYSTGTFSLSNLGMFGVDFFDAILT
PGQGAIMAVGASRPTVVATEDGLLGVKRQMKVNITCDHRVIYGADAAAFLQDLAKLIETN
PQALTL
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgattcgtgaactgttcatgcccgccctcagctccaccatgaccgaaggcaaaattgtc
tcttggctgaaatctcccggggataaggtgaccaaaggggaaacggtgctgattgtggaa
tccgacaaggccgatatggatgtggagtccttctacgacggctatttggcggtgattacc
gtacctgctggcgaagtggcacccgtcggctccaccattggccttgtggcagaaacagaa
gcagaaattgcggaggcagaggcaaaggccaagtcccttgggacggctaccagttctgcg
ccagctccggcctcaacttcgactgtggccaccagtaatggctcaggaacggctcctgta
gtagcggctcctgccgccagtgctgctgtaccggctgggcgagtgatggcctccccccgt
gcccgcaaattggccaaggaacacaaaattgatttgaagaccctcaagggaactggcccc
aatggtcggattacagccgccgatgtggaagctttgattggggcacctgcaacccctgtg
ccacccgtggcaacgtcccctgcgcctatccccacggcaccccctgctactgcggcggtg
gtcgctaaggaggatttggtgcccctgacaacgctgcaaaatgcggttgtgcgcaatatg
gtggccagccttggcattcccgatttccatgtcgcctacacgattacaaccgatgccttg
gatcggctgtatcagcaaattaagtccaaaggggtgacaatgacggcgctccttgccaag
gcgatcgccctgacattgcaaaaacacccaattatgaatgcctactacacagagcagggg
attcaataccgtcgtgatattaacatcgctgttgctgtggcgatgccgggggggggtctg
attacaccggtgctgaagaacgccgatcaaattgacatctacagcctctcccgtacttgg
aaagacttggtggaacgggcgcgcgctaagcaactgcaacctgatgagtacagcacaggc
acctttagcctctcgaacctcggcatgtttggagttgacttctttgatgccattctcacg
cccggccaaggggccattatggcggtgggggcatcgcggccgacggtggttgctacagag
gatggcctgctcggggtaaaacggcagatgaaagtgaatatcacctgtgatcaccgggtg
atctatggtgcggatgcagccgctttccttcaggatttggcgaaactgattgaaaccaat
cctcaagccctgacgctctaa

DBGET integrated database retrieval system