KEGG   Thermosynechococcus vulcanus: NIES2134_112570Help
Entry
NIES2134_112570   CDS       T05980                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tvn  Thermosynechococcus vulcanus
Pathway
tvn00010  Glycolysis / Gluconeogenesis
tvn00020  Citrate cycle (TCA cycle)
tvn00620  Pyruvate metabolism
tvn01100  Metabolic pathways
tvn01110  Biosynthesis of secondary metabolites
tvn01120  Microbial metabolism in diverse environments
tvn01130  Biosynthesis of antibiotics
tvn01200  Carbon metabolism
Module
tvn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tvn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES2134_112570
   00020 Citrate cycle (TCA cycle)
    NIES2134_112570
   00620 Pyruvate metabolism
    NIES2134_112570
Enzymes [BR:tvn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIES2134_112570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl ATP-grasp MadL AATase
Motif
Other DBs
NCBI-ProteinID: BAY51158
LinkDB All DBs
Position
1272604..1273884
Genome map
AA seq 426 aa AA seqDB search
MIRELFMPALSSTMTEGKIVSWLKSPGDKVTKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGEVAPVGSTIGLVAETEAEIAEAEAKAKSLGTATSSAPAPASTSTVATSNGSGTAPV
VAAPAASAAVPAGRVMASPRARKLAKEHKIDLKTLKGTGPNGRITAADVEALIGAPATPV
PPVATSPAPIPTAPPATAAVVAKEDLVPLTTLQNAVVRNMVASLGIPDFHVAYTITTDAL
DRLYQQIKSKGVTMTALLAKAIALTLQKHPIMNAYYTEQGIQYRRDINIAVAVAMPGGGL
ITPVLKNADQIDIYSLSRTWKDLVERARAKQLQPDEYSTGTFSLSNLGMFGVDFFDAILT
PGQGAIMAVGASRPTVVATEDGLLGVKRQMKVNITCDHRVIYGADAAAFLQDLAKLIETN
PQALTL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgaactgttcatgcccgccctcagctccaccatgaccgaaggcaaaattgtc
tcttggctgaaatctcccggggataaggtgaccaaaggggaaacggtgctgattgtggaa
tccgacaaggccgatatggatgtggagtccttctacgacggctatttggcggtgattacc
gtacctgctggcgaagtggcacccgtcggctccaccattggccttgtggcagaaacagaa
gcagaaattgcggaggcagaggcaaaggccaagtcccttgggacggctaccagttctgcg
ccagctccggcctcaacttcgactgtggccaccagtaatggctcaggaacggctcctgta
gtagcggctcctgccgccagtgctgctgtaccggctgggcgagtgatggcctccccccgt
gcccgcaaattggccaaggaacacaaaattgatttgaagaccctcaagggaactggcccc
aatggtcggattacagccgccgatgtggaagctttgattggggcacctgcaacccctgtg
ccacccgtggcaacgtcccctgcgcctatccccacggcaccccctgctactgcggcggtg
gtcgctaaggaggatttggtgcccctgacaacgctgcaaaatgcggttgtgcgcaatatg
gtggccagccttggcattcccgatttccatgtcgcctacacgattacaaccgatgccttg
gatcggctgtatcagcaaattaagtccaaaggggtgacaatgacggcgctccttgccaag
gcgatcgccctgacattgcaaaaacacccaattatgaatgcctactacacagagcagggg
attcaataccgtcgtgatattaacatcgctgttgctgtggcgatgccgggggggggtctg
attacaccggtgctgaagaacgccgatcaaattgacatctacagcctctcccgtacttgg
aaagacttggtggaacgggcgcgcgctaagcaactgcaacctgatgagtacagcacaggc
acctttagcctctcgaacctcggcatgtttggagttgacttctttgatgccattctcacg
cccggccaaggggccattatggcggtgggggcatcgcggccgacggtggttgctacagag
gatggcctgctcggggtaaaacggcagatgaaagtgaatatcacctgtgatcaccgggtg
atctatggtgcggatgcagccgctttccttcaggatttggcgaaactgattgaaaccaat
cctcaagccctgacgctctaa

DBGET integrated database retrieval system