KEGG   Thermosynechococcus vulcanus: NIES2134_114330Help
Entry
NIES2134_114330   CDS       T05980                                 

Gene name
sodB_2
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tvn  Thermosynechococcus vulcanus
Brite
Enzymes [BR:tvn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NIES2134_114330 (sodB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_portal
Motif
Other DBs
NCBI-ProteinID: BAY50985
LinkDB All DBs
Position
complement(1464091..1464693)
Genome map
AA seq 200 aa AA seqDB search
MAFVQEPLPFDPGALEPYGMSAKTLEFHYGKHHKGYVDNLNKLTQDTELADKSLEDVIRT
TYGDAAKVGIFNNAAQVWNHTFFWNSLKPGGGGVPTGDVAARINSAFGSYDEFKAQFKNA
AATQFGSGWAWLVLEAGTLKVTKTANAENPLVHGQVPLLTIDVWEHAYYLDYQNRRPDFI
DNFLNQLVNWDFVAQNLAAA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgtacaagaaccccttccctttgatccgggtgcccttgaaccctatggcatg
tctgcgaaaacccttgaatttcactatggcaaacaccataagggctacgtggataacctc
aataagctgactcaagataccgaactcgctgacaaatcccttgaagatgtcattcgcaca
acctatggcgatgctgccaaagtgggcatcttcaacaatgccgctcaagtgtggaatcac
accttcttctggaatagcctcaagccaggtggcggtggtgtgcctacgggtgatgtggcc
gctcggatcaacagtgcttttgggagctacgacgaattcaaagcccagttcaaaaatgcc
gcggcgacccaatttggcagtggttgggcatggctggtgctcgaagctggcacactgaag
gtgactaaaactgccaatgccgaaaaccccttagttcacggtcaagtgcccctactgacg
attgatgtttgggagcacgcctactatctcgactaccaaaaccgtcgtcccgactttatt
gataacttcctgaaccaattggtgaactgggattttgttgctcagaacttggcggctgcc
taa

DBGET integrated database retrieval system