KEGG   Thermoplasma volcanium: TVG0808604Help
Entry
TVG0808604        CDS       T00042                                 

Gene name
TVG0808604
Definition
(GenBank) aldehyde-ferredoxin oxidoreductase [AOR]
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tvo  Thermoplasma volcanium
Pathway
tvo00030  Pentose phosphate pathway
tvo01100  Metabolic pathways
tvo01120  Microbial metabolism in diverse environments
tvo01200  Carbon metabolism
Module
tvo_M00309  Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TVG0808604 (TVG0808604)
Enzymes [BR:tvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TVG0808604 (TVG0808604)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: BAB59951
UniProt: Q97AK1
LinkDB All DBs
Position
complement(808604..810415)
Genome map
AA seq 603 aa AA seqDB search
MIGGFTGKILRIDLSAGKLSIENTNMTWAKDYIGGQGLATRYYVEEVDPKIDPYDPENEL
IIAPGPLTGTSAPTAARYMAVTKSPLTGTITRSNSGGYFGAKLKHAGFDMIIFKGKSKKP
VYLYVDNGKAELRDASDLWGKDVFETTDILTSRISGNVSVACIGPAGENLVKFASIMNDK
HRAAGRNGVGAVMGSKNLKAIVAGGGRMPAIGDPEKYKIVLPKMLKKIKENPVTSQGLTQ
FGTEVLVNIINKSGIYSNKNLTESGDDPLADDVSGETLAETYLLHNQPCFACPIGCGRVV
RYNERESEGPEYESTWALGPNTGIHDLYTIIAANDNADRLGYDTISAGLTMSAAMELYEN
GKIPDKDVGPTKPKFGNQSALLEMSVKLAYRKDFGSKLAEGSKKLSEMYGDPSVSMSVKG
QEIAAYDPRGVWGMALEYATSNIGGSHMRAYTISNEILGVEPVSDPLKLEGKAELVKYVQ
DFTEVMDCSGLCQFPSFALNLDDYLELVNAVTGFNYTKEEIMKAAERVWNLERLFNLKAG
IKPEDDKLPERFLKDPIPKGPKKGNTVPFEKLIKDYYKVRGWTENGYPTPEKLKELGLEF
YGI
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgatagggggttttacaggtaaaattctgaggattgatctcagcgcgggtaagctttcc
atagagaatacaaatatgacgtgggcaaaggactacattggtgggcaaggccttgctact
cgttattatgtagaagaagttgatccaaagatcgatccttatgatcctgagaacgaactt
ataatagctcccggaccgctaactggcactagcgcacctacagcggcacggtatatggct
gttacgaaaagtccgcttactggtacaataacaagaagcaattcaggaggttacttcgga
gctaaattaaagcacgccggttttgatatgataatattcaaaggaaagtctaagaaacca
gtttatctctatgtagataacggaaaggccgagttgagagatgcatcagacctttgggga
aaagacgtcttcgaaactacagatatacttacgtcgagaataagcggaaacgtaagcgta
gcctgcatcggtccagcaggggaaaaccttgtgaaatttgcctccataatgaatgacaaa
catagagctgctggcagaaacggagtcggggcggttatgggctcaaagaaccttaaagca
atagttgccggtggcggaaggatgcctgccattggagatccagagaaatacaaaattgtg
ctgccgaaaatgcttaaaaaaatcaaagaaaaccctgttacctctcaaggtttaacacag
tttggtaccgaggttctagtaaatataatcaataaatccggcatatattcaaataagaat
ctaacggagtctggagacgaccctcttgcggatgatgtcagcggagagacgttagcagag
acctatctacttcacaaccagccgtgctttgcgtgtccgataggttgcgggagagtagtc
aggtataacgagcgggaaagtgaagggccggaatatgagagcacgtgggcccttggacca
aacacaggaattcatgacctttacactataatagccgcaaacgacaatgcagacaggctc
ggatatgacacaatatccgctggcctaacgatgtccgccgctatggaactctatgaaaat
gggaaaatacctgataaggatgtcggaccaacaaagccgaagttcggaaaccagagcgct
ttgctggagatgagtgtaaaacttgcctacaggaaggattttggatcgaagcttgcggaa
ggctcaaagaagctctcggaaatgtacggagatccatcagtttctatgagtgtaaagggg
caggagattgcagcatacgacccgagaggcgtgtggggcatggcgcttgagtatgcaacc
agcaacataggcggttcccacatgagagcttatacaatatcaaacgagattttaggtgtt
gagccagtatctgatcctctcaagttggaaggaaaggctgaactagttaagtacgtacag
gatttcactgaggtaatggactgttctgggctatgccagtttccctcatttgcactcaac
cttgatgattatttagaactagtaaacgcagttactggattcaactacactaaggaagaa
ataatgaaagctgcagaaagagtctggaacttggaaagattattcaacttaaaggcaggg
ataaaaccagaagacgataagctgcctgaaaggttcctaaaagatccaataccaaagggg
ccaaagaaagggaatacagtacctttcgagaaacttataaaagactattacaaggtaaga
ggatggaccgaaaatggttatccgactccagaaaaactaaaggagcttgggcttgaattt
tacggtatttaa

DBGET integrated database retrieval system