KEGG   Thermoplasma volcanium: TVG1076124
Entry
TVG1076124        CDS       T00042                                 

Gene name
TVG1076124
Definition
(GenBank) aldehyde dehydrogenase
  KO
K18128  D-glyceraldehyde dehydrogenase (NADP+) [EC:1.2.1.89]
Organism
tvo  Thermoplasma volcanium
Pathway
tvo00030  Pentose phosphate pathway
tvo01100  Metabolic pathways
tvo01120  Microbial metabolism in diverse environments
tvo01200  Carbon metabolism
Module
tvo_M00309  Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:tvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TVG1076124 (TVG1076124)
Enzymes [BR:tvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.89  D-glyceraldehyde dehydrogenase (NADP+)
     TVG1076124 (TVG1076124)
SSDB
Motif
Pfam: Aldedh LuxC DUF2884
Other DBs
NCBI-ProteinID: BAB60192
UniProt: Q979W0
LinkDB
Position
complement(1076124..1077605)
AA seq 493 aa
MDGKLYIDGQWVDSSNGDTLTKYNPVTGEVIGKFAAASRDDVDRAFDAAEDAFQKWMDLG
SVERSKIIYKAKELIEENRKELENIIIQENGKPVKEAAEEVDGVLDQMQYYAEWARKLNG
EVVEGTTNHRKIFQYKVPYGTVVALTPWNFPAGMVARKLAPALLTGNTVILKPSSDTPGS
AEWIVKKFIQAGVPKGALNYITGRGSVIGDYIVEHKKVALITMTGSTSTGQRIMQKASAN
MAKLMLELGGKAPFMVWKDADINNALKTLLWAKYWNAGQSCIAAERLYVHEDIYDTFINK
FVELSKKIVVGDPSRADMGPLINTTALKGTEEVVEEAKESGARILYGGSKPDLSGPYKNG
YFFLPTIIDNVDQKSKIFQEEIFAPVIGARKVSDVEEMYSLANDSKYGLASYLFTKDPNL
IFEAAERIRFGELYINMPGPEASQGYHTGFRLTGQAGEGSRYGILEYLKIKNIYVDYSGK
PLQINTVRDDLFQ
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggatggaaaactgtacatagatggacaatgggttgattcgtccaatggtgatacttta
acgaaatacaacccggttactggcgaagtcattgggaaatttgcagcagcatcaagggat
gatgttgatagagcatttgatgcagccgaggacgccttccaaaagtggatggatcttggg
tcagtcgagcgttcaaaaatcatatacaaagcgaaggagctcatagaggaaaaccggaag
gaacttgaaaatataataatacaagagaatggaaaacctgttaaagaagccgctgaagaa
gtcgatggtgtgctcgatcaaatgcaatactatgcggaatgggccagaaagctgaacgga
gaggtcgttgaagggactactaaccaccgcaagatattccaatataaagtcccgtacggt
actgtagttgcccttactccgtggaatttcccagcaggtatggttgcgaggaagcttgct
ccggcactcctcacaggcaatacggtcatattgaagccaagcagtgatacaccaggaagc
gctgaatggatagtgaaaaagtttatccaggctggcgttccaaagggcgctctcaattat
ataacaggcaggggttcggttatcggtgattatatagtagagcataagaaagttgcatta
atcaccatgactggctctaccagcaccggccaaaggataatgcagaaagcttctgctaac
atggcaaaacttatgctcgaattgggaggaaaggccccctttatggtttggaaggacgcc
gacataaacaatgcgcttaaaaccctgctctgggcaaagtactggaacgccggccagtcc
tgcatagcggcggaaaggctctacgtacacgaggatatatacgacacgttcattaacaag
ttcgtggaactgagcaagaagattgtagtcggcgacccgtcaagggcagacatgggcccg
ttgataaatactactgcattgaagggaacagaagaggtcgttgaagaggctaaagaaagc
ggtgcacgcatactatatggcggatccaaacccgatctttctggtccatacaagaatgga
tacttcttcctgcctacgataattgacaatgtcgatcagaaatcaaagatattccaggag
gagatatttgcaccagtaataggcgcaagaaaggtgtctgacgtagaggaaatgtacagc
cttgccaatgattccaagtacgggcttgcatcgtacttgtttactaaagatccgaacctt
atattcgaagccgcagaacgcataaggtttggcgaactctacataaacatgccaggccca
gaggcatcgcaaggataccacacaggtttcaggcttactggtcaagcaggggaaggaagc
agatacggcatacttgagtaccttaaaataaagaacatatacgtagactactcaggaaag
ccgttgcaaataaatactgtaagagatgatctatttcagtaa

DBGET integrated database retrieval system