KEGG   Thermoplasma volcanium: TVG1298537Help
Entry
TVG1298537        CDS       T00042                                 

Gene name
TVG1298537
Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tvo  Thermoplasma volcanium
Pathway
tvo03030  DNA replication
tvo03410  Base excision repair
tvo03420  Nucleotide excision repair
tvo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TVG1298537 (TVG1298537)
   03410 Base excision repair
    TVG1298537 (TVG1298537)
   03420 Nucleotide excision repair
    TVG1298537 (TVG1298537)
   03430 Mismatch repair
    TVG1298537 (TVG1298537)
Enzymes [BR:tvo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TVG1298537 (TVG1298537)
    6.5.1.6  DNA ligase (ATP or NAD+)
     TVG1298537 (TVG1298537)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     TVG1298537 (TVG1298537)
DNA replication proteins [BR:tvo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    TVG1298537 (TVG1298537)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     TVG1298537 (TVG1298537)
DNA repair and recombination proteins [BR:tvo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     TVG1298537 (TVG1298537)
   NER (nucleotide excision repair)
    Other NER factors
     TVG1298537 (TVG1298537)
   MMR (mismatch exicision repair)
    Other MMR factors
     TVG1298537 (TVG1298537)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: BAB60403
UniProt: Q979A1
LinkDB All DBs
Position
complement(1298537..1300303)
Genome map
AA seq 588 aa AA seqDB search
MKFSLVTDAFEKMSKTTKRTELTEILVELLKSADEDLQSLVYLIEGKLAPDYQGIETQMS
DKLIIKALSIVSNIPEEAVSETYSKLGDIGSVAREIAAKKNMRSLVNEDLTVKYVHDTLM
RMAKTSGSGSTKARIDAYVDLALSGTPADLMYITRIITGKLRIGVSDATILDAIILAFSD
EKYSEEIENAYNFHPDLGYIAVQLRLGNLESVINMGPTPMVPFKVMLAERLRSVDEIVQK
MNGKCAFEYKYDGMRTEIHIVDEKVRLFSRGNEETTGQFPDIVKSAKETFHVSSVILDGE
AVPYNPETGELYPFQVISQRRGRKYDLDKVSNEIPITVFLFDIVYINGKDLSKTPYAERR
RILEGLFKENDNFKLAKRIVSSDTGTITKFFNQAIEDGCEGLVAKSMADDSYYKAGARGW
LWIKLKRDYQAQLWDTIDLTVVGAFMGHGRRSGTYGALLLATYNEKNDTFETVCKLGSGF
TDDVLFSLPKRFAEFVSKEKPARVVSTIEPDVWIYPSIVMEIIGAEITISPVHTCAFGII
EKDAGLSIRFPRFTGKWRDDKKPEDSTTTQEIIEMYKEQKKTLTEEKS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcactggtaacggacgcttttgagaagatgtcaaagacgactaagcgcaca
gaacttacggaaatattggtagagctccttaaatccgcagatgaagacttacaatccctt
gtttatctaattgagggaaaacttgctccagattaccagggcatagaaactcagatgtct
gataaactcataataaaagcactctccatagtttcaaatataccggaggaagctgtatca
gaaacttactccaagctaggagatatcggatccgtggcaagagaaattgcagcgaaaaaa
aacatgagatctctcgtgaatgaggatttaaccgttaagtacgtacacgatacacttatg
agaatggcgaaaactagcggttcaggaagtacaaaggctagaatagatgcctatgtagac
ttggctcttagcgggactcctgccgatctcatgtatataactcggataataacaggaaaa
ctccgtattggtgtatccgatgcgacaatacttgacgcaataatcctggctttttcagat
gaaaagtacagcgaggaaatagagaatgcatataatttccatcccgatctcggatacata
gctgtacagttaagattaggaaacttagaatcagtaataaacatgggccccaccccaatg
gttccgtttaaggtaatgttagctgaacgactacgttctgtagatgaaatagtccaaaaa
atgaacggtaaatgtgctttcgaatacaagtacgacggtatgcgaacagagatccatata
gtagatgaaaaagtgaggttgttttcgagaggaaacgaagaaactacaggtcaatttcct
gatatagtgaaatcggctaaagaaactttccatgtctcttctgttatactggatggggaa
gctgttccctacaacccagagacaggggaactttatcccttccaggttatttctcagaga
aggggccggaagtatgacctcgataaagtttccaacgaaattccaataaccgtttttctc
ttcgatatagtatatatcaatggaaaagatctgtcaaagactccatatgctgaacggcgc
aggatccttgaaggtcttttcaaggaaaatgacaatttcaaactggctaagaggattgta
tcaagtgatactggaaccataacaaagttctttaatcaagcaatagaagacggatgcgag
ggccttgttgccaagagcatggccgatgattcttattataaggctggtgctaggggatgg
ctttggataaaactaaagagagactatcaggcccagctttgggatactattgatctaacg
gtagttggtgcattcatgggccacggaagaaggagtggaacgtacggcgctttgcttctt
gcaacttataacgaaaagaatgatactttcgaaactgtgtgtaaacttggttcgggattt
acagatgatgttctattttcgttgccaaaaaggtttgctgagtttgtcagcaaagaaaaa
ccagccagagttgtaagcactatcgaaccagatgtttggatatacccctcaattgtcatg
gagataataggcgctgaaataacaataagccctgtacatacgtgtgccttcggcataata
gaaaaagatgcaggcttgtctataagattccccaggttcaccggcaaatggagagacgac
aaaaaaccagaagattctacaacaactcaggaaataatagaaatgtacaaggaacagaaa
aaaacattaacagaagagaagagttaa

DBGET integrated database retrieval system