KEGG   Thermoplasma volcanium: TVG1298537Help
Entry
TVG1298537        CDS       T00042                                 

Gene name
TVG1298537
Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tvo  Thermoplasma volcanium
Pathway
tvo03030  DNA replication
tvo03410  Base excision repair
tvo03420  Nucleotide excision repair
tvo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tvo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TVG1298537 (TVG1298537)
   03410 Base excision repair
    TVG1298537 (TVG1298537)
   03420 Nucleotide excision repair
    TVG1298537 (TVG1298537)
   03430 Mismatch repair
    TVG1298537 (TVG1298537)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tvo03032]
    TVG1298537 (TVG1298537)
   03400 DNA repair and recombination proteins [BR:tvo03400]
    TVG1298537 (TVG1298537)
Enzymes [BR:tvo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TVG1298537 (TVG1298537)
    6.5.1.6  DNA ligase (ATP or NAD+)
     TVG1298537 (TVG1298537)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     TVG1298537 (TVG1298537)
DNA replication proteins [BR:tvo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    TVG1298537 (TVG1298537)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     TVG1298537 (TVG1298537)
DNA repair and recombination proteins [BR:tvo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     TVG1298537 (TVG1298537)
   NER (nucleotide excision repair)
    Other NER factors
     TVG1298537 (TVG1298537)
   MMR (mismatch exicision repair)
    Other MMR factors
     TVG1298537 (TVG1298537)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: BAB60403
UniProt: Q979A1
LinkDB All DBs
Position
complement(1298537..1300303)
Genome map
AA seq 588 aa AA seqDB search
MKFSLVTDAFEKMSKTTKRTELTEILVELLKSADEDLQSLVYLIEGKLAPDYQGIETQMS
DKLIIKALSIVSNIPEEAVSETYSKLGDIGSVAREIAAKKNMRSLVNEDLTVKYVHDTLM
RMAKTSGSGSTKARIDAYVDLALSGTPADLMYITRIITGKLRIGVSDATILDAIILAFSD
EKYSEEIENAYNFHPDLGYIAVQLRLGNLESVINMGPTPMVPFKVMLAERLRSVDEIVQK
MNGKCAFEYKYDGMRTEIHIVDEKVRLFSRGNEETTGQFPDIVKSAKETFHVSSVILDGE
AVPYNPETGELYPFQVISQRRGRKYDLDKVSNEIPITVFLFDIVYINGKDLSKTPYAERR
RILEGLFKENDNFKLAKRIVSSDTGTITKFFNQAIEDGCEGLVAKSMADDSYYKAGARGW
LWIKLKRDYQAQLWDTIDLTVVGAFMGHGRRSGTYGALLLATYNEKNDTFETVCKLGSGF
TDDVLFSLPKRFAEFVSKEKPARVVSTIEPDVWIYPSIVMEIIGAEITISPVHTCAFGII
EKDAGLSIRFPRFTGKWRDDKKPEDSTTTQEIIEMYKEQKKTLTEEKS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcactggtaacggacgcttttgagaagatgtcaaagacgactaagcgcaca
gaacttacggaaatattggtagagctccttaaatccgcagatgaagacttacaatccctt
gtttatctaattgagggaaaacttgctccagattaccagggcatagaaactcagatgtct
gataaactcataataaaagcactctccatagtttcaaatataccggaggaagctgtatca
gaaacttactccaagctaggagatatcggatccgtggcaagagaaattgcagcgaaaaaa
aacatgagatctctcgtgaatgaggatttaaccgttaagtacgtacacgatacacttatg
agaatggcgaaaactagcggttcaggaagtacaaaggctagaatagatgcctatgtagac
ttggctcttagcgggactcctgccgatctcatgtatataactcggataataacaggaaaa
ctccgtattggtgtatccgatgcgacaatacttgacgcaataatcctggctttttcagat
gaaaagtacagcgaggaaatagagaatgcatataatttccatcccgatctcggatacata
gctgtacagttaagattaggaaacttagaatcagtaataaacatgggccccaccccaatg
gttccgtttaaggtaatgttagctgaacgactacgttctgtagatgaaatagtccaaaaa
atgaacggtaaatgtgctttcgaatacaagtacgacggtatgcgaacagagatccatata
gtagatgaaaaagtgaggttgttttcgagaggaaacgaagaaactacaggtcaatttcct
gatatagtgaaatcggctaaagaaactttccatgtctcttctgttatactggatggggaa
gctgttccctacaacccagagacaggggaactttatcccttccaggttatttctcagaga
aggggccggaagtatgacctcgataaagtttccaacgaaattccaataaccgtttttctc
ttcgatatagtatatatcaatggaaaagatctgtcaaagactccatatgctgaacggcgc
aggatccttgaaggtcttttcaaggaaaatgacaatttcaaactggctaagaggattgta
tcaagtgatactggaaccataacaaagttctttaatcaagcaatagaagacggatgcgag
ggccttgttgccaagagcatggccgatgattcttattataaggctggtgctaggggatgg
ctttggataaaactaaagagagactatcaggcccagctttgggatactattgatctaacg
gtagttggtgcattcatgggccacggaagaaggagtggaacgtacggcgctttgcttctt
gcaacttataacgaaaagaatgatactttcgaaactgtgtgtaaacttggttcgggattt
acagatgatgttctattttcgttgccaaaaaggtttgctgagtttgtcagcaaagaaaaa
ccagccagagttgtaagcactatcgaaccagatgtttggatatacccctcaattgtcatg
gagataataggcgctgaaataacaataagccctgtacatacgtgtgccttcggcataata
gaaaaagatgcaggcttgtctataagattccccaggttcaccggcaaatggagagacgac
aaaaaaccagaagattctacaacaactcaggaaataatagaaatgtacaaggaacagaaa
aaaacattaacagaagagaagagttaa

DBGET integrated database retrieval system