KEGG   Thioalkalivibrio versutus: TVD_03000Help
Entry
TVD_03000         CDS       T03959                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tvr  Thioalkalivibrio versutus
Pathway
tvr00620  Pyruvate metabolism
tvr00680  Methane metabolism
tvr00710  Carbon fixation in photosynthetic organisms
tvr01100  Metabolic pathways
tvr01120  Microbial metabolism in diverse environments
tvr01200  Carbon metabolism
Module
tvr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TVD_03000
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TVD_03000
   00680 Methane metabolism
    TVD_03000
Enzymes [BR:tvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TVD_03000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 T3SS_needle_F UB2H Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AKJ94402
UniProt: A0A0G3G4F7
LinkDB All DBs
Position
complement(627214..630057)
Genome map
AA seq 947 aa AA seqDB search
MTRSDQHDRFLPKDKELRARVRLFGELLGNVIHDLEGQAVFDAVEKLRRGFVSLRKDEDP
DLRRQLMADITHFDASLTERVIRAFSIYFSLVNIAEEDLFYRWRRAQVSSGEPLWTGSFD
QTLRELHGEGVTAEELERLLNELHYQPVFTAHPTEARRRTTMENQRRVFETADRLNQPGL
GEEERRLITEELETQIQILWRTNEVRVKKPQVQDEIKYGLFYFEESLFEAIPQSYRFLEK
AIRRIYGVNPDGSLPVRIPAFLHFGSWIGGDRDGNPNVTPEVTELSCRLAMEQVLREYLK
RVNHLRNVLTHSSFMCQPSQAFLDSLDADSNIANAVFQGASDRFESEPYRRKLYIMRYRL
RETLDTVVRRVRGEAAVLPTNSAYADAQAFLNDLKLIRDSLVSHGDRNIASGALTDLIRL
VETFGFHLHHLDVRQESTVHSDAIAELLRQLAPDTDYAALDETGRQQALSELIALENLPE
VDRKALGESTRETLRVFEVIQSMRREVGPDGIGTYVISMTHAASHVLEVLLLGRLAGLAG
NDEEGNPFCHLRISPLFETIEDLLHVEDVLEGLLSNPVYARLLAASGNIQDVMLGYSDSC
KDGGILASSWNLYEAQKKIVGITDRFGVRCQLFHGRGGTVGRGGGPTHESILAQPPATVQ
GRIKFTEQGEVLSYKYSNVETAVYELGMGATGVMLASRSLIRPPRKDRDDYRATMHELAQ
AGEDAYRELIDRTERVLDYFYEITPVQEIGFLNIGSRPSHRRKTDRSKSSIRAIPWVFGW
AQARHTLPAWYGIGTALAQWRGDDPERLAQLQRMYQEWPFFRSLLSNCQMALTKADMRTA
AEYARLCSDPELAERIYVLVREEHSRTVTEVLRVAQLDRLMDETPLLARSLQRRNPYLDP
LNSIQIHLLRESRQFDAEADDDTDENPWLSPLLRSINAIAAGMRNTG
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgactcgaagcgatcaacacgaccgattcctccccaaggacaaggaactgcgcgcccgc
gtgcgcctgttcggggaactcctgggcaacgtgattcacgacctggaaggccaggccgtg
ttcgacgcggtggagaagctgcgccgcggcttcgtcagcctgcgcaaggacgaggatccg
gacctgcgccgccagctgatggccgacatcacgcacttcgacgcctcgctgaccgaacgc
gtgatccgggccttcagcatctacttcagcctggtcaacatcgccgaggaagacctgttc
taccgctggcgccgcgcccaggtctccagcggcgagccgctgtggaccggctccttcgac
cagaccctgcgcgagctgcatggcgaaggcgtcaccgccgaggagctggaacgcctgctc
aacgagctgcactaccagccggtgttcaccgcccaccccaccgaggcccgccgccggacc
acgatggagaaccagcgccgcgtgttcgagaccgccgaccggctgaaccagccggggctg
ggcgaggaggaacgccgcctgatcaccgaggaactggagacccagatccagatcctctgg
cgcaccaacgaggtgcgggtgaaaaagccgcaggttcaggacgagatcaagtacggcctg
ttctatttcgaggagagcctgttcgaggccatcccgcagtcctaccgcttcctcgagaag
gccatccgccggatctacggcgtcaacccggacggcagcctgccggtacgcatcccggcc
ttcctgcactttggctcctggatcggcggcgaccgcgacggcaacccgaacgtgactccc
gaggtcaccgagctgtcctgccgtctggcgatggaacaggtgctgcgcgagtacctcaag
cgggtcaaccatctgcgcaacgtgctgacgcactcgtccttcatgtgccagccgtcgcag
gcatttctcgacagcctggacgccgactccaatatcgccaacgcggtgttccagggcgcc
tccgaccgcttcgagagcgagccctaccggcgcaagctctacatcatgcgctaccgtctg
cgcgagaccctggacacagtggtgcgccgggtccgcggcgaggccgccgtgctgccgacc
aacagcgcctatgccgacgcccaggccttcctgaacgatctcaagctgatccgcgactcg
ctggtcagccatggtgatcgcaacatcgccagcggcgcgctgaccgatctgatccgcctg
gtcgagaccttcggctttcacctgcaccacctggacgtgcgccaggagtccaccgtccac
tccgacgcgatcgcggaactgctgcgccagttggcaccggacaccgactacgccgcgctg
gacgagaccggccgccagcaggcgctgagcgaactgatcgccttggagaacctgcccgag
gtggaccgcaaggcgctgggcgagagcacccgcgagaccctgcgcgtgttcgaggtgatc
cagagcatgcgccgcgaggtcggtccggacggcatcggcacctacgtgatctccatgacc
cacgccgcctcgcatgtactggaggtcctgctgctgggccgcctggcaggtctcgcgggc
aacgacgaagaaggcaacccgttctgccatctgcgcatctcgccgctgttcgagaccatc
gaggacctgctgcatgtcgaggacgtcctcgagggcctgctgtccaacccggtgtatgca
cgactgctggccgcctccgggaacatccaggacgtcatgctcggctactccgattcctgc
aaggacggcggcatcctcgcctccagctggaacctctacgaggcacagaagaagatcgtc
ggcattaccgaccgcttcggcgtgcgctgccagctgttccacggccgcggcggcaccgtc
gggcgcggcggcggaccgacccacgagtccatcctcgcccagcccccggccacggtgcag
ggccggatcaagttcaccgaacagggcgaggtactgtcgtacaagtactccaacgtggag
accgcggtgtacgagctgggcatgggtgcgaccggcgtcatgctcgcctcgcgcagcctg
atccggccgccgcgcaaggatcgcgacgactaccgcgccaccatgcacgagctcgcgcag
gctggcgaggatgcctaccgcgagctgatcgaccgcaccgagcgcgtgctcgattacttc
tacgagatcaccccggtacaggagatcggcttcctgaatatcggctcgcggccatcgcac
cggcgcaagaccgaccgctccaagagctcgatccgcgcgatcccctgggtcttcggctgg
gcccaggcgcgccacaccctgcccgcctggtacggcatcggcaccgcgctggcacagtgg
cgcggcgacgaccccgaacgcctggcccagttgcagcgcatgtaccaggagtggccgttc
ttccgctcgttgctgtccaactgccagatggccctgaccaaggccgacatgcgcaccgcc
gcggagtacgcccgcctgtgcagcgacccggaactggccgaacgcatctacgtcctggtg
cgtgaggaacacagccgcaccgtcaccgaagtgctgcgcgtggcacaactggaccgactg
atggacgaaacgcccctgctggcgcgttcgctgcaacggcgcaacccgtacctggacccg
ctcaacagcatccagattcacctgctgcgcgagtctcgccagttcgacgccgaggccgac
gacgacaccgacgaaaacccgtggctgtcgcccctgctgcgctcgatcaacgcgatcgcc
gcgggcatgcgcaacaccggctaa

DBGET integrated database retrieval system