KEGG   Thioalkalivibrio versutus: TVD_03410Help
Entry
TVD_03410         CDS       T03959                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
tvr  Thioalkalivibrio versutus
Pathway
tvr00910  Nitrogen metabolism
tvr02010  ABC transporters
Module
tvr_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:tvr00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    TVD_03410
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    TVD_03410
Transporters [BR:tvr02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    TVD_03410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AKJ94474
UniProt: A0A0G3G254
LinkDB All DBs
Position
715527..716465
Genome map
AA seq 312 aa AA seqDB search
MSAILDRTMTFGSGRERPVVEASPTRPVARKATTIAARPQPRPGADPGAWARRLRNTAAV
VVPPVVVTALFLLIWEMMASSPGAVLPAPSQVITDTWELIVNPFYDYGGNDVGMAWQLLA
SLERVAYGYALAVVAGIGLGVLVGQSTWAMRGLDPLFQVLRTVPPLAWLPISLAAFQASN
PSAIFVIFITAIWPIIINTSVGIRNISQDYVNVARVLRLNGFEYFTKIMLPAAAPYVFSG
LRIGIGLAWLAIVAAEMLIGGVGIGFFIWDAWNASMLSDIVLALVYVGLVGFFLDRLVAI
VGNWVTRGTQAG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccattctcgaccgcaccatgaccttcggctccgggcgcgagcgcccggtggtc
gaggcatcgcccacccggcccgtggcccggaaggccaccaccattgcggccaggccccag
ccgcgccccggggcagatcccggggcctgggcccggcgcctgcgcaatactgccgcggtc
gtggtgccgccggtggtcgtcacggcgctttttttgcttatctgggagatgatggcgtcc
tccccgggagccgtgttgcccgccccgagccaggtgattaccgacacctgggaactgatc
gtcaatcccttctatgactacggcggcaacgacgtcggcatggcctggcagttgctggcc
agcctcgagcgcgtggcctatggctatgcgctggcggtggtcgccggcattggcctgggc
gtgctggtgggtcagtccacctgggcgatgcgcggactcgacccgctgttccaggtcctg
cgtaccgtgccgccgctggcctggctgccgatctcgctggctgcgttccaggccagcaat
ccgtcggcgatcttcgtgatcttcatcaccgcgatctggccgatcatcatcaacacctcc
gtcggcatccggaatatctcgcaggactacgtgaacgtggcccgcgtgctgcgcctgaac
ggcttcgagtacttcaccaagatcatgctcccggccgccgcgccgtatgtcttttccggt
ttgcgcatcgggatcggtctcgcctggctggcgatcgtggccgccgagatgctgatcggt
ggtgttggtatcggtttctttatctgggatgcctggaacgcctccatgctcagcgacatc
gtgctcgcgctcgtctacgtcggcctggtcgggttcttcctcgaccgtctggttgccatc
gtcggcaactgggttacccgtggcacgcaggccggctga

DBGET integrated database retrieval system