KEGG   Thioalkalivibrio versutus: TVD_07230Help
Entry
TVD_07230         CDS       T03959                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
tvr  Thioalkalivibrio versutus
Pathway
tvr00061  Fatty acid biosynthesis
tvr00780  Biotin metabolism
tvr01100  Metabolic pathways
tvr01212  Fatty acid metabolism
Module
tvr_M00083  Fatty acid biosynthesis, elongation
tvr_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:tvr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TVD_07230
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TVD_07230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tvr01004]
    TVD_07230
Enzymes [BR:tvr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     TVD_07230
Lipid biosynthesis proteins [BR:tvr01004]
 Fatty acid synthase
  Component type
   TVD_07230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AKJ96451
UniProt: A0A0G3GC61
LinkDB All DBs
Position
complement(1559964..1560422)
Genome map
AA seq 152 aa AA seqDB search
MDDFNVQEIMRYLPHRYPFLMVDRVLEWEAGSYLTGIKNVSINEPYFQGHFPIKPVMPGV
LILEALAQATGLLAFKTEEARNENQDKQQLYLFVGIDEARFRRQVVPGDQLHLRVDLKRT
VRGIWRFDAVAKVGDDVCATAQLMCSGQEIPA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
gtggatgactttaatgtccaggagatcatgcgctacctgccgcatcgttacccgttcctg
atggtggatcgggtgctggagtgggaggcgggcagctatctgacggggatcaagaacgtc
agcatcaacgaaccgtatttccaggggcacttcccgatcaagccggtgatgcccggggtt
ctgatcctcgaggccctggcacaggccaccggcctgctcgcgttcaagaccgaagaggcg
cgtaacgagaaccaggacaagcagcagctatacctgtttgtcgggatcgacgaggcgcgc
tttcggcgccaggtggtacccggggatcaactccacctgcgggtcgatctgaagcgtacg
gtgcggggcatctggcgcttcgacgcggtcgcgaaggtgggcgacgacgtgtgcgccacg
gcgcagctcatgtgttccggtcaggaaatcccggcgtga

DBGET integrated database retrieval system