KEGG   Thioalkalivibrio versutus: TVD_09480Help
Entry
TVD_09480         CDS       T03959                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
tvr  Thioalkalivibrio versutus
Pathway
tvr00710  Carbon fixation in photosynthetic organisms
tvr01100  Metabolic pathways
tvr01120  Microbial metabolism in diverse environments
tvr01200  Carbon metabolism
Module
tvr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TVD_09480
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TVD_09480
Enzymes [BR:tvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TVD_09480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AKJ95573
UniProt: A0A0G3G2U8
LinkDB All DBs
Position
complement(2044400..2044732)
Genome map
AA seq 110 aa AA seqDB search
MSDIQNFKPVQKYETFSYLPEMNADQVRRQIEYTIAQGWNPAVEYSEKEHAMSNYWYMWK
LPMFGEQSVEAVLSEIEQCRRANPGMMVRFLAYDNYAQSQGTAFVVDRGR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatattcagaacttcaagccggtgcagaagtacgagaccttctcttacctgccc
gagatgaacgccgatcaggttcgccgtcagatcgagtacacgattgcccagggctggaac
ccggcggtcgagtacagcgaaaaagaacacgccatgtccaactactggtacatgtggaag
ctcccgatgttcggcgagcagtctgtcgaggccgtgctgagcgagatcgagcagtgccgc
cgtgccaaccccggcatgatggttcgcttcctcgcctacgataactatgcccagagccag
ggcacggccttcgtggtcgatcgcggtcgctaa

DBGET integrated database retrieval system