KEGG   Trametes versicolor: TRAVEDRAFT_127790Help
Entry
TRAVEDRAFT_127790 CDS       T04795                                 

Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
tvs  Trametes versicolor
Pathway
tvs00010  Glycolysis / Gluconeogenesis
tvs00020  Citrate cycle (TCA cycle)
tvs00260  Glycine, serine and threonine metabolism
tvs00280  Valine, leucine and isoleucine degradation
tvs00310  Lysine degradation
tvs00380  Tryptophan metabolism
tvs00620  Pyruvate metabolism
tvs00630  Glyoxylate and dicarboxylate metabolism
tvs00640  Propanoate metabolism
tvs01100  Metabolic pathways
tvs01110  Biosynthesis of secondary metabolites
tvs01130  Biosynthesis of antibiotics
tvs01200  Carbon metabolism
Module
tvs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tvs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tvs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRAVEDRAFT_127790
   00020 Citrate cycle (TCA cycle)
    TRAVEDRAFT_127790
   00620 Pyruvate metabolism
    TRAVEDRAFT_127790
   00630 Glyoxylate and dicarboxylate metabolism
    TRAVEDRAFT_127790
   00640 Propanoate metabolism
    TRAVEDRAFT_127790
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TRAVEDRAFT_127790
   00280 Valine, leucine and isoleucine degradation
    TRAVEDRAFT_127790
   00310 Lysine degradation
    TRAVEDRAFT_127790
   00380 Tryptophan metabolism
    TRAVEDRAFT_127790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tvs04147]
    TRAVEDRAFT_127790
Enzymes [BR:tvs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     TRAVEDRAFT_127790
Exosome [BR:tvs04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TRAVEDRAFT_127790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA Pyr_redox_3 FAD_oxidored NAD_binding_8 K_oxygenase HI0933_like FAD_binding_2 THF_DHG_CYH_C AlaDh_PNT_C DAO 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 19408226
NCBI-ProteinID: XP_008040606
JGI: 127790
LinkDB All DBs
Position
Unknown
AA seq 502 aa AA seqDB search
MQAAVRRLRQTAGAQVGRWQQQRGVASSSEPYDAVIIGGGELPRPGGYVAAIKAAQHGLR
TACIEKRGALGGTCLNVGCIPSKAMLNNSHMYHQTQHDLKRRGIDVTDVKLNLPQMLKAK
EDAVTGLTKGVETLFKQNKVDYFKGTASFVNSTKLSVKLNDGGETEVNGKNIIIATGSEV
SPFPGGSIVIDEEQIVSSTGALALQKVPEKMVVIGGGIIGLEMSSVWSRLGAQVTVVEFL
GGIGGAGIDEEIAKQFQRSLQKQGLKFMLNTKVLSAEKKDGKVFIKTEAAKGGKEETLEA
DVVLVAVGRRPYTEGLNLEAAGVELDNRGRVVIDDQFNTSVKGIKCIGDVTFGPMLAHKA
EEEGIAAVEYISKGHGHVNYHAIPSVVYTHPEVAWVGKTEQELKAAGVQYKVGKFPFAAN
SRAKTNLDTEGSVKFITEKETDRILGVHIIGPNAGEMIAEGVLAVEYGASAEDIARTTHA
HPTLSEAFKEAAMAAFDKPIHF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctgctgtgcgccggttgcgtcagactgctggtgcccaggtcggtcgctggcag
cagcagcgcggtgttgccagctcctccgagccctatgatgcggtcatcatcggtggaggc
gagttacctcgccccggtggttacgtcgctgcgatcaaggccgctcagcacggtctgcgg
acggcgtgtattgagaagcgtggtgctcttggcggaacttgcctgaacgtcggatgcatt
ccctcaaaagctatgttgaacaactcgcacatgtaccaccagacgcagcatgacctgaag
cggaggggtattgatgtcaccgatgtcaagctcaacctgcctcagatgctgaaggcgaag
gaggatgccgtgactggcctgacgaagggtgtcgagaccctcttcaagcagaataaggtc
gactacttcaagggcaccgcttccttcgtcaactccaccaagctcagtgtcaagctgaac
gacggtggcgagaccgaggttaacggcaagaacatcatcatcgcgaccggctctgaggtc
tctcccttccccggtggttccattgtgatcgacgaggagcagatcgtctcgtcgactggt
gctcttgcgctccagaaggtccccgagaagatggttgtcattggtggtggtatcatcggt
ctcgagatgagctccgtatggagccgtctcggtgctcaggttaccgttgtcgagttcttg
ggtggcattggtggcgcgggtatcgatgaggagattgccaagcagttccagcgctctctc
cagaagcagggcctgaagttcatgttgaacaccaaggtcctctctgctgagaagaaggac
ggcaaggtcttcatcaagaccgaggctgcgaagggcggcaaggaggaaacacttgaggcg
gacgtcgtcttggtcgctgttggccgtcgcccctataccgaaggcctcaacctcgaggct
gccggtgtcgagctcgacaaccgcggccgcgtcgtcatcgacgaccagttcaacaccagc
gtaaagggcatcaagtgcatcggtgacgtcaccttcggcccgatgcttgcgcacaaggcc
gaggaagagggtatcgccgccgttgagtacatcagcaagggccacggccatgtcaactac
cacgcgatcccgtccgtcgtctacacccaccccgaggtcgcttgggtcggcaagaccgag
caagagctcaaggccgcgggtgtgcagtacaaggtcggcaagttccccttcgcagcgaac
tcgcgtgcgaagacgaacctcgacaccgagggcagcgtcaagttcatcaccgagaaggag
accgaccgcattctcggcgtacacatcatcggccctaacgccggtgagatgattgcggag
ggtgtccttgctgtcgagtacggtgcgagcgcagaggacattgcgcggacaacccacgcc
caccccacgctcagcgaggcgttcaaggaggcggcaatggctgcgttcgacaagcccatc
cacttctag

DBGET integrated database retrieval system