KEGG   Trametes versicolor: TRAVEDRAFT_139674Help
Entry
TRAVEDRAFT_139674 CDS       T04795                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tvs  Trametes versicolor
Pathway
tvs03030  DNA replication
tvs03410  Base excision repair
tvs03420  Nucleotide excision repair
tvs03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TRAVEDRAFT_139674
   03410 Base excision repair
    TRAVEDRAFT_139674
   03420 Nucleotide excision repair
    TRAVEDRAFT_139674
   03430 Mismatch repair
    TRAVEDRAFT_139674
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tvs03032]
    TRAVEDRAFT_139674
   03400 DNA repair and recombination proteins [BR:tvs03400]
    TRAVEDRAFT_139674
Enzymes [BR:tvs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TRAVEDRAFT_139674
    6.5.1.6  DNA ligase (ATP or NAD+)
     TRAVEDRAFT_139674
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     TRAVEDRAFT_139674
DNA replication proteins [BR:tvs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    TRAVEDRAFT_139674
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     TRAVEDRAFT_139674
DNA repair and recombination proteins [BR:tvs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     TRAVEDRAFT_139674
   NER (nucleotide excision repair)
    Other NER factors
     TRAVEDRAFT_139674
   MMR (mismatch excision repair)
    Other MMR factors
     TRAVEDRAFT_139674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase eIF-3c_N
Motif
Other DBs
NCBI-GeneID: 19409132
NCBI-ProteinID: XP_008033017
JGI: 139674
LinkDB All DBs
Position
Unknown
AA seq 692 aa AA seqDB search
MDEDEASAASSPEDPDEGEDEIEVDEDLDAEDEGVASKNAEAALSKTKEVDLPGGWKAGD
PVPYAALAKVFALIEATTKRLEKTALLTSFLLLVIRRRAQGDSQSLLQAVYLCINRLCPD
YVGIELGIGESLLIKAISESTGRSLSVVKADLKKEGDLGLVAMNSKNSQKTLFKPKPLTL
PTVFKNLKEIALSSGHSSQNKKVSIITKLMASCQGQEAKYIIRSLEGKLRIGNAERTVLV
ALAHAAVLAEQEISNKRSSAEKLASRLEESASIIKQVYSELPNYDLVIPALLDVGVDRLI
EVCKLTPGVPLKPMLAKPTKAIGEVLDKFEGKKFTCEYKYDGERAQVHKLEDGSIAVFSR
NSEDMSKKYPDLMAQLPSCIKEGTKTFVFDAEAVAIDKDTGKLMPFQELSRRKRKDVKVE
DIKVRVCLFAFDLLYLNGEPLLQRDFGTRRGLLQEHFLPVDGEFQFAKSSDCDTTDEIQT
FLEESVKDGCEGLMVKMLEGELSHYQPSRRTVNWLKLKKDYLAGVGDSLDLVVVGAYYGK
GKRTNVYGAFLLACYDADSEEYQTICKIGTGFSDEALQAHAATLKPLEMTTPRGDVKVGG
AKPDVWLEPKVVWEVLTADLSLSPIYTAAQGLVEERGISLRFPRFIRIREDKAADDATGP
EQIAEMYQRQALAQGSKGKKGKGGGDADDGFW
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggacgaagccagtgcggcctcaagtcctgaggacccggatgaaggcgaggat
gagatagaagtggacgaagatttggacgcagaggatgaaggtgttgcttccaagaatgcg
gaagctgctctgtcaaagacgaaggaagttgacctgccaggaggttggaaggccggagac
cccgtaccgtacgcggcactagccaaagtattcgcgctcatcgaggcaacaacaaaacgg
ttggagaagaccgctttgctcacatctttcctcctgctcgtgatccgcaggcgggctcaa
ggggactctcagtctctacttcaggctgtctatctctgtatcaaccggttatgcccagat
tatgtcggcatcgagctgggaatcggggagagtctgctcatcaaggcaataagcgaatca
actgggcgaagcttgtcagtggtaaaggctgacctcaagaaagagggcgacctcggcctc
gtggcaatgaactcgaagaacagtcagaagacgctcttcaagcccaagcctttaaccctc
ccaacggtgttcaagaacctgaaggagattgctctgagcagtggtcattcatcccagaac
aagaaggtgtctatcatcacgaaactcatggcctcgtgtcagggccaagaggcaaagtac
atcatccgcagtctagagggcaagctacgaatcggaaacgcggagcgcacggtccttgtc
gccctcgcacatgccgctgttctcgcagaacaggagatttcgaataaacggtcaagcgcg
gagaagctcgcttcccgcctagaagagtctgcgagcatcatcaagcaggtgtacagcgaa
cttcccaactacgatctcgtcatccctgcactcctcgatgtcggagtcgacaggctgatc
gaagtgtgcaagctgacgccaggcgtgccgctgaaacccatgctggcgaagccgacgaag
gcgatcggagaggtgctcgacaaattcgaaggcaagaaattcacgtgcgagtacaagtat
gacggcgaacgtgcacaagtgcacaagctcgaggacggttccatcgcagtcttcagccgc
aactcggaggacatgagcaagaagtacccggacctcatggcgcagctgccaagctgcatc
aaggagggcacgaagacgttcgtgttcgacgcggaggcggtcgcgatcgacaaggacacg
ggcaagctcatgccgttccaggagctcagccggcggaagcgcaaggacgtcaaggtcgag
gacatcaaagtccgcgtctgcctctttgcgttcgatcttctctaccttaatggcgagccg
ttgttgcagagagacttcgggacacggcgcgggctgctgcaggagcacttcctgcccgtg
gacggcgagtttcagttcgcgaagtcgtccgactgcgataccacagatgagatccagacg
ttcctcgaggagagcgtcaaggacggctgcgagggtctcatggtgaagatgctcgagggc
gagctgagccactaccagcccagtcggcgaaccgtaaattggctcaaactgaagaaagac
tacctcgcgggcgtcggcgactcgctcgacctcgtcgtcgtaggcgcctactacggcaag
ggcaagcgcacgaacgtctacggcgcgttcctgctcgcgtgttacgacgcagactccgag
gagtaccagacgatctgcaagatcggcaccgggttcagcgacgaggcgctccaggcgcac
gccgcgacgctcaagccactcgagatgaccacgccgcgcggggacgtcaaagtcggcggc
gcgaagcccgacgtctggcttgagcccaaggtcgtctgggaggtgctcacggcggacctc
agtctgagcccgatctacacggccgcgcagggtctggtcgaggagcgcggcatctcgctg
cgtttcccccgtttcatccggatccgggaggacaaggctgcggatgacgcgacggggccg
gagcagatagcagaaatgtaccagcgccaggccctcgcgcagggcagcaagggcaagaag
ggcaaggggggcggcgacgcggacgacggattctggtag

DBGET integrated database retrieval system