KEGG   Trametes versicolor: TRAVEDRAFT_140830Help
Entry
TRAVEDRAFT_140830 CDS       T04795                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
tvs  Trametes versicolor
Pathway
tvs00052  Galactose metabolism
tvs00500  Starch and sucrose metabolism
tvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TRAVEDRAFT_140830
   00500 Starch and sucrose metabolism
    TRAVEDRAFT_140830
Enzymes [BR:tvs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     TRAVEDRAFT_140830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19409194
NCBI-ProteinID: XP_008033410
JGI: 140830
LinkDB All DBs
Position
Unknown
AA seq 970 aa AA seqDB search
MRAILFAALLFLRVIALAREPSKFEHGRSFLADDKAPSLNVSSCPGYVVASQQETHNGLT
IQLTLAGPACSAFGHDVANLTVEVTYETTTRLHVNIYDTEQRQFTIPPDVVPLSAGEDDA
TLPTGADLEFHHNTHPFEFWVTRRSEPDATPLFDTRLQSLPPTPIPAWVPGDNSTAFDGF
PLVFEDQYLQLTSALPHGANVYGLGEVLASSGFRRDVGTDGGSGTLQTFWARDSPDPIDE
NIYGSHPIYLEHRYDESTRRSKSHGVFHFGAAGSDILLQTPPSSPVSLIQYRLVGGTLDF
YFFSGPSPQEVIEQYGELIGLPTWQPAWGFGFQLCRWGYANVSETREQVAKMREANIPLE
VMWNDIDVYHALRDFTTDPDSFPADQLKDFIAELTANHQHYIPIVDAAIAKLVNDSDVYD
PYTRGNELDVWLKNPDGTEYLGQVWPGYTVFPDWFANNTQAFWTEGLRNWSNSGVNFSGI
WLDMNEASSFCIGSCGTGANLTAATIPTMFFPGTPGNLVTDYPEGYNATIWGPSGNITIN
GTLTFGNSSSPPPALAKRGLGEAAEPGVNLNSPPYALHNADGFLSTHTVSTNATHANGLV
ELDVHNLWGLMEEKATHHALLDVHPGKRPFLISRSTFPSSGRYTGHWLGDNISKWQYMVQ
SIQGVLQFQLYQIPFVGADTCGFQGNTDEELCGRWMQLSAFMPFYRNHNVRSALSQEPYR
WESVANASRTAIGIRYSLLPYWYTLFANASLRGSPPVRALFYEFPDEPELFTVDRQYLVG
RDLLVTPVLTPNVSTVDGIFPGQGRVIWRDWYTHKVVDAAISANTTLDAPLGHINVHIRD
GSALLLHASPAYTIEETRGGPFALLVAQAADGYAFGTAYLDDGETVPPTPNTTLKISARK
GTVSVVPHGNFKVVQTLDKITVLGASDVSPTEVSVNGKPVKSWEFDSEVQRLVVSAIHVD
LNVPATVSWK
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgatcctattcgccgcactgctcttcctgcgagtgatcgctctagccagggaa
ccttcaaagtttgaacacggcagaagcttcctcgcagacgacaaagcgccttcgctgaat
gtgtcgtcatgtccaggatatgttgtcgcgtcacaacaagagacccacaatggcctgacg
atccagcttacgcttgccggtccggcctgtagcgctttcggccacgatgttgccaatctt
accgttgaagtcacctacgaaacaacgacgagactgcacgtcaacatctacgacacagaa
cagagacaattcactataccgccggacgtcgtccctttgtcggcgggagaggatgacgcg
actttgccaacgggtgctgacctcgagttccaccacaacacgcaccctttcgagttctgg
gtgacgcgacggtccgagccagacgctacccctctgttcgacacgcgccttcagtccctt
ccgccgacgccaataccggcctgggtaccaggggataactccactgcgtttgacggattc
ccgctcgtgtttgaggaccaatacctgcaactcacctcggcgttgccgcatggtgcgaac
gtctatggtctcggcgaagtccttgctagtagcggcttccgacgagatgtgggcaccgat
ggcgggtctgggactctccagactttctgggcacgagacagtccggatcctatagatgag
aacatctatgggtcgcaccccatctacctggaacatcggtacgatgagagcaccaggcgc
tcaaagtcgcacggtgtctttcactttggcgctgcagggtcagacatcctgctacagact
ccgccatcttcgcccgtttcgttgatccagtaccggctggttgggggcacactcgacttc
tacttcttctctggacccagccctcaggaggtgatcgagcaatacggcgagctcatcggc
ctgcccacttggcagcccgcctggggcttcggcttccagctttgccgatggggatacgcc
aacgtcagcgagacgagagagcaagtggcaaagatgcgagaggcgaacattccactggag
gtcatgtggaacgacatcgacgtgtatcacgcgcttcgcgacttcacgaccgaccccgac
agcttccctgctgaccagttgaaggactttattgccgagctgacggccaaccaccaacac
tatattcccatagtggacgctgcgatcgcgaagctcgtcaatgattccgacgtgtatgac
ccttacacaagaggaaacgagctggacgtatggctgaagaaccccgacggcacagagtac
cttgggcaggtttggccaggatacacggtgttcccagactggttcgcgaacaacacccag
gcgttctggaccgaaggcctccgcaactggtctaattcaggtgtgaacttctcggggata
tggctggacatgaacgaggcgtcatcgttctgcatcggctcatgcggaaccggagctaat
ctgaccgctgctacaattccgacgatgttcttccctggcacgccagggaacctggtaacg
gactatcctgaaggctacaacgcgaccatctgggggccgagtggaaacataaccataaat
ggcacgctgacgttcgggaactcctcctccccgcctccggcactcgcgaagagaggcctc
ggagaagcggcggagcccggcgtgaacctcaacagccctccatatgcactgcacaacgcg
gacggcttcttgtcgacccacacggtctcgaccaacgccacacatgcgaacgggctggtc
gagctcgacgtgcacaacctgtggggcctgatggaagaaaaagcgacacaccacgccctg
ctcgacgtgcacccaggaaagcgtccgtttctgatcagccgctcgacgttccctagctca
ggcaggtacaccggacattggctcggcgataacatcagcaaatggcagtacatggtgcag
agcatccagggcgtgctccagttccagctctaccagattcccttcgtcggcgcggacacg
tgcgggttccagggcaacacggacgaggagctttgcgggcgctggatgcagctctctgcg
ttcatgccgttctatcgaaaccacaacgttcggagcgcgctttcgcaagagccgtatcgg
tgggagagcgtggcgaacgcctcacgcacggcaatcggcatccgatacagcctactacca
tactggtacacactcttcgccaacgcgtcgctgcgcgggagcccgccggtccgtgcgctc
ttctacgagttccccgacgaaccggagctgttcactgtggatcgccaatatctcgtcggg
agagatcttctggtcacccccgttctcactccaaacgtctccacggtcgacggtatcttc
cctgggcaaggacgcgtcatctggcgggactggtacacccacaaggtcgtcgatgcggcc
atctcggcgaacacgacgctcgatgcgcccctcgggcacattaacgtccacattcgggac
ggctctgcccttctgctgcatgccagtccggcgtacacgatcgaagaaacgcgtgggggt
ccgttcgcactgctcgtagcgcaggccgccgacggctacgccttcggaacggcatacctg
gacgatggggaaactgttccgccgacgcccaacacgacactgaagatctccgcacgcaag
ggcactgtctcagttgttcctcacggtaatttcaaagtcgtgcaaactctagacaagatc
accgttctcggggcgtctgacgtttcgcctacggaggtttctgtcaacggcaagcccgtc
aaaagctgggagttcgactccgaggtccaacggctcgtagtctcggcgattcatgtcgat
ctgaatgtacctgcgacggtgtcgtggaagtag

DBGET integrated database retrieval system