KEGG   Trametes versicolor: TRAVEDRAFT_152358Help
Entry
TRAVEDRAFT_152358 CDS       T04795                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
tvs  Trametes versicolor
Pathway
tvs00020  Citrate cycle (TCA cycle)
tvs00310  Lysine degradation
tvs00380  Tryptophan metabolism
tvs01100  Metabolic pathways
tvs01110  Biosynthesis of secondary metabolites
tvs01130  Biosynthesis of antibiotics
tvs01200  Carbon metabolism
Module
tvs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tvs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRAVEDRAFT_152358
  09105 Amino acid metabolism
   00310 Lysine degradation
    TRAVEDRAFT_152358
   00380 Tryptophan metabolism
    TRAVEDRAFT_152358
Enzymes [BR:tvs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     TRAVEDRAFT_152358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 19409839
NCBI-ProteinID: XP_008041455
JGI: 152358
LinkDB All DBs
Position
Unknown
AA seq 1003 aa AA seqDB search
MHRLARLPRVVQTVHGARFRYGLQPLARTYATAAKAPSPNDPFANGTNAYYAEEMYRLWR
QDPKSVHASWDVYFSGMAKGLTSPQAFQPPPSLVPTPTDGAPALHTNGGAELDDHLKVQL
LVRAYQVRGHHVADLDPLGILDPDLNPVHPPELELSRYGFSERDLEKQITLGPGILPHFA
TEDRKTMSLGEIIKLCKRIYCGAMGIQYIHIPDKEQCDWIRERVEIPKPWNYTVEEKRMV
LDRLIWSESFEKFMASKYPNEKRFGLEGCESLIPGMKALIDRSVEHGVKHVTIGMPHRGR
LNVLANVIRKPIEAILNEFSGTAEDDDFPAGDVKYHLGANYVRPTPSGKKVALSLVANPS
HLEAEDPVVLGKTRALQQFEQDEQTHNTAMGVLLHGDAAFAGQGVVYETMGFHNLPNYGT
GGTIHLIVNNQIGFTTDPRFARSTPYPSDIAKAIDAPIFHVNGDNVEAVNFVCQLAADWR
AKWKKDVVIDIVCYRRYGHNETDQPSFTQPRMYKAIEKQPTTLQKYTKFLVGRGTFTEKD
IDEHKKWVWGTLEKAASLAKDYVPSSKEWLSASWPGFPSPKELAEQTLPTRATGASEDTL
KRIGKVISTFPEGFKPHRNLARILTNRGKTIDEGSNIDWATAEALAFGTLALENTHVRVS
GQDVERGTFSQRHAVIHDQENEQQYVPLNNLGSNQARFVVCNSSLSEFGTLGFELGYSLV
SPSSLTIWEAQFGDFANNAQCIIDQFIASGERKWLQRTGLVVNLPHGFDGQGPEHSSGRI
ERFLQLCDDHPHVYPTPEKIERQHQDCNMQVVYPTTPANYYHVLRRQIHRDFRKPLIVFF
SKSLLRHPKARSDLSEMTGDSHFQRYIPDSHPENLVEPEKIRRHILCSGQVYHTLLQERE
DKGINDVVISRLEQVSPFPYDLLTPHLDKYPNADILWCQEEPLNNGSWTYVGPRIMTAAN
ETQHHKGKYPLYAGREPTSSVATGSKAIHKKQIEKFLATAFGQ
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgcacagactcgctcggctgccccgcgtcgtacagaccgtgcacggcgcccgcttccgc
tatggcctccaaccgctggcccgcacgtacgcgaccgccgccaaggccccctcgccaaac
gaccccttcgcgaacggcacgaacgcttactacgctgaggagatgtacagactctggagg
caggatcccaagtctgtgcacgcgtcgtgggatgtctacttctccggcatggccaagggc
ttgaccagcccgcaggccttccaaccccctcccagcttggttcctacccccaccgacggc
gcgcctgcgttgcacactaacggtggcgctgagctggatgaccatttgaaggtccaactg
ctcgtccgtgcataccaagtgcgcggtcatcacgttgccgaccttgaccccctgggtatc
ctggaccccgatctcaaccctgtgcacccgcctgagctagagctaagccggtatggcttc
tctgagcgcgacctcgagaagcagatcacccttggtcctggtatccttccccatttcgcg
acggaagacaggaaaacgatgtcattgggcgagatcatcaaactttgcaaacgcatctac
tgtggtgccatgggtatccagtacattcacattcccgacaaggagcaatgtgactggatt
cgggagcgtgtcgagatcccaaaaccgtggaactacaccgtggaggagaagcggatggtg
ctggaccgcttgatttggtcagagtcgttcgagaagttcatggcgagcaaatacccgaac
gagaagcggttcggtctcgagggctgcgagtcgctcattcccggaatgaaggcgctcatc
gaccgctcggtcgagcacggcgtcaagcatgtcacgatcggcatgccccatcgtggtcgt
ctcaacgtcctcgcgaacgtgatcaggaaacctatcgaggccatcctgaacgagttctcg
ggcaccgcggaggacgacgacttccccgctggtgatgtgaagtaccacttgggcgccaac
tatgtgcgtcccacgccttcggggaagaaggtcgcgctgtccctcgttgccaacccctca
catctcgaggccgaggaccccgttgtgcttggcaagactcgtgcactccagcagttcgag
caggatgagcagacgcacaacacggccatgggcgtgctgctccacggtgatgcggcgttc
gccggccagggtgtcgtttacgagaccatgggcttccacaacctacccaactacggcact
ggcggaacgattcacctgatcgtcaacaaccagatcggcttcacaaccgaccctcgattc
gcgcgttcgacgccttacccatccgacatcgcgaaggccattgacgcgccgatcttccat
gtgaacggcgacaacgtcgaggcggtcaacttcgtgtgccaactcgcggccgactggcgc
gcgaagtggaagaaggacgtcgtcatcgacatcgtctgctaccgccgctacggccacaac
gagacggaccagcccagcttcacgcagccgcgtatgtacaaggccatcgagaagcagccg
acgacgctccaaaagtacaccaagttcctcgtgggacgcggtacgttcacggagaaggac
atcgacgagcacaagaagtgggtgtggggcacgcttgaaaaagccgcgagtctcgccaag
gactacgtgccgtcgagcaaggagtggctctctgcgtcgtggcccgggttcccctcaccc
aaagagcttgctgagcagaccctgcccacccgtgccactggcgcgtccgaggacaccctc
aagcgcatcggcaaggtcatttcgaccttccccgagggcttcaagccccaccgcaacctc
gctcgtatcctgaccaaccgcggtaagaccatcgacgagggttcgaacatcgactgggcg
actgccgaggccttggccttcggtacgctcgcgctggagaacacccacgtgcgcgtgtcc
ggtcaggacgtcgagcgtggcacgttctcgcaacgccacgcggtcatccacgaccaggag
aacgagcagcagtacgtgccgctgaacaaccttggtagcaaccaggcgcgcttcgttgtc
tgcaactcgtcgttgtccgagttcggcacgctagggttcgagcttgggtactcgcttgtc
tcgccgagctcgctcaccatctgggaggcgcagttcggtgacttcgcgaacaacgcgcag
tgcatcatcgaccagttcatcgcgtctggcgagcggaagtggctgcagcgcactggcctg
gtcgtcaacttgccccatggtttcgacggccagggcccggagcactccagcggccgtatc
gagcgcttcctgcaactgtgcgacgaccacccgcacgtgtaccctaccccggagaagatt
gagaggcagcaccaggactgcaacatgcaggttgtctaccctacgaccccggcaaactac
taccacgtcctccgtcgccagatccaccgcgacttccggaaaccgttgatcgtattcttc
tcgaagtccctcctccgccaccctaaggcccgctcagacctttccgagatgactggcgac
tcgcacttccagcgctacatccctgattctcacccagagaacctggtcgagcccgaaaag
atccgtcgccacattctctgctcgggtcaagtctaccacaccctcctccaggagcgtgag
gacaagggcatcaacgacgtcgtgatcagcagacttgagcaggtctcaccgttcccctac
gacctcctcacgccccacctcgacaaatacccgaacgcggacatcctctggtgccaagag
gagcccttgaacaacggctcgtggacatacgtcggcccgcgcatcatgaccgccgcgaac
gagacgcagcaccacaagggcaagtacccgctctacgcgggccgcgagcccacgagctcc
gtcgcgaccggcagcaaggcgatccacaagaagcagatcgagaagttcctcgcgaccgca
ttcgggcagtag

DBGET integrated database retrieval system