KEGG   Trametes versicolor: TRAVEDRAFT_155607Help
Entry
TRAVEDRAFT_155607 CDS       T04795                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
tvs  Trametes versicolor
Pathway
tvs00500  Starch and sucrose metabolism
tvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRAVEDRAFT_155607
Enzymes [BR:tvs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     TRAVEDRAFT_155607
Glycosyltransferases [BR:tvs01003]
 Polysaccharide
  Storage polysaccharide
   TRAVEDRAFT_155607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_4 Glycos_transf_1 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 19410026
NCBI-ProteinID: XP_008044389
JGI: 155607
LinkDB All DBs
Position
Unknown
AA seq 747 aa AA seqDB search
MSEVKRDVRNPLLFECAWEVANKVGGIYTVIKTKVPVTVSEYGDRYTLIGPLSYKTAPME
VEAQEPKDPYLAATLDSMRAAGVKILYGRWLIEGAPNVLLFDTGSQYSRLDEWKGDLWNL
AGIPTPPNDHETNETIVFGYIVAWFLGDYVARRQDKAIIAHFHEWQAGLAIPLCRKRHID
VTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSSAHCADVFTT
VSHITAYESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNLHSTAKAKINDFVRGHFYGHYD
FDLDNTLYMFTAGRYEYRNKGVDMFIESLARLNFRLKKSGSKVTVIAFIIMPATTHSYTV
DALKGQAVTKQLHDTVTEIQNRIGARLFEHAMSSNGEHGTLPTPDDLLSDEDKVLLKRRI
FALKRNALPPITTHNMADDANDPILNQIRRVQLFNSSSDRVKIVFHPDFLNSNNPILGLD
YEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSATTNLSGFGCFMQDLIERPQDEGCYI
VDRRSQSVEDSVNQLTDHMFSFSQKTRRQRINQRNRVERLSPLLDWKNLGIEYSKARQLA
LRRAYPDEFYGAGGAGDEEEEGLVDFGMERMTLPISVPASPRFRMSGIATPGDLGTLTEE
MQSLNTSDYRGMNWPSQQDDDEDEYPFPLVMKVRSRAGSVMSGASTPGGGRSKSLSEGDL
QRADEALSNVTEGQTNGVNGVNGNSAY
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagtcaagcgcgacgtccgcaaccccctcctcttcgagtgcgcctgggaggtc
gcaaacaaggtcggcggcatctacaccgtcatcaagacgaaagtacccgtcaccgtctcc
gagtatggcgaccgctacaccctcatcggccccctctcctacaagaccgcccccatggag
gtcgaggcccaggagcccaaggatccctacctcgccgcgaccctcgatagcatgcgcgcc
gccggggtcaagatcctctacggacgctggcttattgagggcgcgccaaacgtgctgctc
ttcgataccggcagccagtactcgcgcctcgacgagtggaagggcgatctctggaatctc
gcgggcattcccaccccacccaacgaccacgaaaccaacgagacgattgtctttggctac
atcgtagcgtggttcctcggcgattatgttgcccggcgacaggacaaggccatcattgcg
cacttccacgaatggcaagctggtctcgcgatccccctgtgccgcaagcgccatatcgac
gttactactgtcttcaccacccacgcgaccctgctcggacgttacctctgcgcgggctcc
gtcgatttctacaataacctgcagtacttcgatgtcgaccacgaggcgggcaagcgcggt
atctaccaccggtactgcatcgaacgctcttcggcccactgtgcggacgtgttcacgacg
gtttcgcacatcaccgcgtacgagagcgagcacttactcaagcgcaaacccgatggcgtc
ctccccaacggtctcaacgtcgtcaagttccaggctatgcacgagttccagaacttgcac
tcgaccgcgaaggcgaagatcaacgacttcgtgcgtggccatttctacggccattacgac
tttgacctcgacaacaccctctacatgttcaccgctggccgctacgagtaccggaacaag
ggagtggacatgttcatcgagtccttggcgcgtctcaacttccgcctcaagaagtcgggc
tctaaagtcaccgtcatcgcgttcatcattatgcccgccacaacccattcgtataccgtc
gacgcgctcaagggccaggctgtaacaaagcagctgcacgacaccgtgaccgaaatccag
aaccgcataggtgctcgcctattcgagcacgctatgagctccaatggtgaacatggaacg
ctgccgacacccgacgacctgctatcggacgaagacaaggttcttctgaagcgccgcatc
ttcgcactcaagcgcaacgcgcttcctcccatcacgacgcacaacatggcggacgacgcg
aacgacccgatcttgaaccagatccgccgcgtccagctcttcaactcgtcctcggaccgc
gtgaagatcgtcttccaccccgacttcctgaacagcaataacccgatcctcggcctcgac
tacgaggagttcgtgcgtggatgccatctcggcgtgttccccagctactacgaaccctgg
ggatacaccccagcggaatgcacggtcatgggcatcccttcggcgacgaccaacctgtcc
gggttcggatgcttcatgcaagacctgatcgagcgcccgcaggacgagggctgctacatc
gtcgaccggcgctcgcagtcggtcgaggactccgtgaaccagctcacggaccacatgttc
tcgttctcgcagaagacgcggcggcagcgcatcaaccagcgcaaccgcgtcgagcgcctc
tcgccgctgctcgactggaagaacctcgggatcgagtactcgaaggcgcgccagctcgcg
ctccggcgcgcgtacccggacgagttctacggcgcgggcggcgcgggcgacgaggaggag
gagggcctcgtcgactttggcatggagcgcatgacgctcccgatcagcgtccccgcgagc
ccgcgcttccgcatgtcgggcatcgcgacccccggcgacctcggcacgctcacggaggag
atgcagagcctcaacacgagcgactaccgcggcatgaactggccgtcgcagcaggacgac
gacgaggacgagtacccgttcccgctggtgatgaaggtgcggtcgcgcgcgggctcggtc
atgagcggcgcgagcacgcctgggggcgggcgctcgaagagcctgagcgagggcgacctg
cagcgcgcggacgaggcgctcagcaacgtcaccgagggccagacgaacggcgtcaacggc
gtcaacggcaacagcgcgtattga

DBGET integrated database retrieval system